Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 25 of 54|Showing 1201-1250 of 2672
bilwinco.com favicon

Bilwinco

bilwinco.com

0
ManufacturingDenmarkmediumMEDIUM

Bilwinco is a well-established Danish manufacturer specializing in high-quality weighing and packaging machinery primarily serving the food and hardware industries. Founded in 1996, the company offers customized solutions to enhance production efficiency and profitability. Their market position is strong within manufacturing sectors requiring precise weighing and packaging solutions. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to their target industries. Technically, the website employs modern web technologies including JavaScript, Google reCAPTCHA for bot protection, and Cookiebot for GDPR-compliant cookie management. The site is built on a Sitebuilder CMS platform and hosted with a reputable registrar and DNS provider. Performance and mobile optimization are good, with accessibility and SEO features well implemented. From a security perspective, the site enforces HTTPS with a good SSL configuration and uses security best practices such as CSRF protection cookies and bot detection. However, some security headers like Content-Security-Policy and X-Content-Type-Options are not explicitly set, and DNSSEC is not enabled, which could be improved. No vulnerabilities or exposed sensitive data were detected. Overall, the website is trustworthy and compliant with privacy regulations, featuring a comprehensive privacy policy and cookie consent mechanism. Contact information is available via contact forms, though no direct emails or phone numbers were found. There is no visible incident response or vulnerability disclosure information, which could be added to enhance security transparency.

-
83
17
90
62
80
20
manufacturingweighingmachinerypackagingmachineryfoodindustryhardwareindustry+2 more
JavaScriptGoogle reCAPTCHACookiebotHTML5+1
2025-06-23T19:08:15.558Z
agrolab.dk favicon

Agrolab A/S

agrolab.dk

0
OtherDenmarkmediumMEDIUM

Agrolab A/S is a well-established Contract Research Organization specializing in field research and regulatory consulting within the agricultural and food production sectors, primarily serving the EU North Zone including Scandinavia and the Baltic states. The company holds recognized certifications such as GEP and GLP, reinforcing its credibility and expertise in the industry. Their website reflects a professional and consistent brand image, offering clear information about their services including drone imaging and research and development. Technically, the website is built on a modern WordPress platform utilizing popular plugins for SEO, marketing, and GDPR compliance. The infrastructure supports good performance and mobile optimization, with integration of major analytics and marketing tools such as Google Analytics, Facebook Pixel, and LinkedIn Insight Tag. The hosting provider appears to be UnoEuro, a known hosting service. From a security perspective, the site uses HTTPS with good SSL configuration and implements cookie consent mechanisms compliant with GDPR. While some security headers are not explicitly detected, no critical vulnerabilities or exposed sensitive data were found. The WHOIS data confirms the legitimacy of the domain registration, consistent with the business information presented. Overall, Agrolab's digital presence is strong, with good content quality, technical implementation, and privacy compliance. The absence of a terms of service page and explicit security policy are minor gaps. Strategic recommendations include enhancing security headers, maintaining up-to-date software, and adding incident response information to further strengthen trust and security posture.

25
80
2
85
62
70
20
agriculturefieldresearchregulatoryconsultinggepglp+3 more
WordPressYoast SEOWPBakery Page BuilderSlider Revolution+7
2025-06-23T19:08:15.416Z
ctas.dk favicon

Conveyor Technique A/S

ctas.dk

0
TransportationDenmarkmediumHIGH

Conveyor Technique A/S is a Danish company specializing in the design, calculation, supply, and installation of innovative conveyor solutions worldwide. Their offerings range from small manual systems to large PLC-controlled robotic conveyor lines, with a focus on industrial painting applications and internal transport solutions. The company serves a global market with over 1,000 installations, targeting industrial manufacturers including automotive and motorcycle sectors. The website reflects a professional B2B business model with clear contact information and multilingual support via WPML. Technically, the website is built on WordPress using the Divi theme, incorporating common plugins such as Easy Video Player and Cookie Law Info for video content and cookie consent management respectively. The site is mobile-optimized and moderately performant, though some media playback issues were noted. SEO and accessibility features are basic but functional. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism, but lacks visible security headers and explicit security or privacy policies. No vulnerability disclosure or incident response information is provided, which could be improved to enhance trust and compliance. The domain uses privacy protection for WHOIS data, which is common but reduces transparency. Overall, the website presents a moderate risk profile with good business credibility but room for improvement in security best practices and privacy compliance. Strategic enhancements in security headers, policy disclosures, and media content quality would strengthen the site's trustworthiness and compliance posture.

25
25
2
85
72
60
20
conveyorindustrialtransportmanufacturingb2b+1 more
WordPressDivi ThemejQueryEasy Video Player plugin+2
2025-06-23T19:08:15.340Z
pipol.com favicon

Pipol A/S

pipol.com

0
TechnologyDenmarkmediumMEDIUM

Pipol A/S is a Denmark-based company specializing in international ERP implementations, particularly focusing on Microsoft Dynamics 365 solutions. Established in 2000, the company has built a strong market position with local expertise in over 85 countries and a large team of more than 4500 Dynamics 365 consultants. Their business model centers on providing centralized management combined with local delivery and support, targeting international companies seeking efficient and risk-minimized ERP implementations. The website reflects a professional and consistent brand image with clear service offerings and a strong emphasis on global reach and local knowledge. Technically, the website is built on the Webflow CMS platform, utilizing modern JavaScript libraries such as jQuery and analytics tools including Microsoft Clarity and Google Tag Manager. The site is hosted on servers associated with Dandomain, with good SSL configuration and moderate performance. Mobile optimization and SEO practices are well implemented, though accessibility features are basic. The presence of cookie consent mechanisms and a privacy policy indicates compliance with GDPR requirements. From a security perspective, the site uses HTTPS and has domain transfer protections in place, but lacks DNSSEC and explicit security headers. There is no visible security policy or incident response information, nor a vulnerability disclosure program. The domain WHOIS data is consistent with the business claims, showing a long-established registration without privacy protection, enhancing trustworthiness. Overall, Pipol's website demonstrates a mature digital presence with good business credibility and privacy compliance. Security posture is adequate but could be improved by adding security headers, DNSSEC, and incident response disclosures. The site is accessible without WAF or blocking mechanisms, allowing full content analysis.

70
68
17
65
52
85
100
erpmicrosoftdynamics365internationalbusinessconsultingtechnologyservices
jQuery 3.4.1WebflowGoogle Tag ManagerMicrosoft Clarity+2
2025-06-23T19:08:14.207Z
buusjensen.dk favicon

Buus Jensen

buusjensen.dk

0
FinanceDenmarkmediumMEDIUM

Buus Jensen is a well-established, independent accounting and auditing firm based in Copenhagen, Denmark. The company offers a range of professional services including auditing, economic advisory, and a proprietary digital bookkeeping system called BUUS JENSEN Online. With over 50 employees and a stable leadership team of seven partners, the firm emphasizes personalized client relationships and comprehensive financial support. Their market position is that of a trusted mid-sized player in the Danish finance sector, supported by partnerships with recognized accounting networks such as UHY and Revisorgruppen Danmark. Technically, the website is built on WordPress with modern plugins for SEO, multilingual support, and cookie consent management. The site employs Google Analytics and Google Tag Manager for analytics and tracking, alongside Google reCAPTCHA for form security. The website is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital infrastructure. Performance is moderate, with room for optimization. From a security perspective, the site uses HTTPS and implements a comprehensive cookie consent mechanism compliant with GDPR. The contact form is protected by reCAPTCHA, and no sensitive data is exposed in the HTML. However, some security headers are not explicitly detected and could be improved. The absence of WHOIS data limits domain trust verification, but the professional presentation and consistent business information mitigate concerns. Overall, Buus Jensen presents a professional and trustworthy online presence with strong privacy compliance and a solid technical foundation. Strategic improvements in security headers and incident response visibility would further enhance their security posture and trustworthiness.

90
83
17
85
77
85
-
accountingauditingfinanceconsultingprivacy+4 more
WordPressYoast SEO pluginContact Form 7Weglot translation plugin+4

Partner Domains:

uhy-us.com
partner
revisorgruppen.dk
partner
2025-06-23T19:08:14.121Z
eiva.com favicon

EIVA a/s

eiva.com

0
EnergyDenmarkmediumMEDIUM

EIVA a/s is a well-established engineering company specializing in software and hardware solutions for maritime survey, offshore, and shallow water construction industries. With over 45 years of experience, EIVA offers a comprehensive portfolio including software products, equipment sales and rental, integrated system solutions, 24/7 support, and professional training services. Their market position is strong, supported by a professional website, active social media presence, and a broad customer base in the energy and transportation sectors. Technically, the website employs modern web technologies such as Google Tag Manager, Cookiebot for consent management, and lazy loading for performance optimization. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital infrastructure. Security-wise, the site enforces HTTPS and uses secure forms but lacks explicit security headers and a public security policy or incident response information, which are areas for improvement. The absence of WHOIS data for the domain is a notable anomaly, slightly reducing trust in domain registration transparency, though the overall business credibility remains high. Strategic recommendations include publishing a dedicated security policy, enhancing security headers, and providing incident response contacts to strengthen trust and compliance.

-
95
17
100
82
80
100
maritimesurveyengineeringsoftwarehardware+5 more
HTML5CSS3JavaScriptGoogle Tag Manager+4
2025-06-23T19:08:13.237Z
jvl.dk favicon

JVL A/S

jvl.dk

0
TechnologyDenmarkmediumMEDIUM

JVL A/S is a Danish company specializing in integrated stepper and servo motors, offering innovative modular interfaces including Industrial Ethernet solutions. The company positions itself as a leader in the motion control technology sector, targeting industrial and automation markets. The website reflects a professional business presence with clear descriptions of products and services, although explicit contact details and comprehensive corporate information are limited on the public site. Technically, the website employs a proprietary SEO & CMS system by Media2 Online, leveraging technologies such as jQuery, Jssor Slider, and Cookiebot for cookie consent management. Google Analytics is used for visitor tracking, indicating a moderate level of digital maturity. The site is moderately optimized for performance and mobile devices but could benefit from enhanced accessibility and security header implementations. From a security perspective, the site uses HTTPS and implements a cookie consent mechanism compliant with GDPR. However, no explicit security policies or incident response contacts are publicly available. The absence of WHOIS data due to privacy protection is typical for commercial entities in Denmark and does not raise immediate concerns. Overall, the security posture is adequate but could be improved with additional transparency and technical hardening. The overall risk assessment suggests a legitimate and professionally managed website with room for improvement in security best practices and corporate transparency. Strategic recommendations include enhancing security headers, publishing security and incident response policies, improving mobile and accessibility features, and maintaining compliance documentation to strengthen trust and resilience.

30
83
17
88
62
70
20
servomotorssteppermotorsindustrialethernetmotioncontrolautomation
jQueryjQuery ColorboxJssor SliderGoogle Analytics+1
2025-06-23T19:08:11.587Z
iterator-it.dk favicon

Iterator IT Iterator-IT

iterator-it.dk

0
TechnologyDenmarksmallMEDIUM

Iterator IT is a Danish technology company specializing in custom IoT solutions and business-driven software development. Founded in 2016, the company focuses on digitalizing production processes, optimizing business operations, and creating data-driven value for its clients. Their services include IoT consulting, sensor integration, cloud data collection, and application development, targeting businesses seeking tailored technology solutions. The website reflects a professional and consistent brand image with a clear focus on technology and innovation in the IoT space. Technically, the website is built on WordPress using a modern and feature-rich theme (Brooklyn) and incorporates numerous JavaScript libraries for enhanced user experience. It employs Google Analytics and Tag Manager for visitor tracking and includes a cookie consent mechanism compliant with GDPR requirements. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Hosting and domain registration are consistent with the company's Danish origin. From a security perspective, the website enforces HTTPS with a valid SSL certificate and uses cookie consent banners to manage user privacy. However, it lacks DNSSEC for DNS security and does not implement advanced security headers, which could be improved. No critical vulnerabilities or exposed sensitive data were detected. The absence of a privacy policy and terms of service pages is a compliance gap that should be addressed. Overall, Iterator IT presents a credible and professional online presence with a solid technical foundation and moderate security posture. Strategic improvements in privacy documentation and security headers would enhance compliance and trustworthiness.

15
10
2
70
72
65
100
iotsoftwaredevelopmenttechnologybusinesssolutionscustomsoftware+1 more
WordPressPHPjQueryGoogle Analytics+4
2025-06-23T19:08:10.807Z
socialeretshjaelp.dk favicon

Den Sociale Retshjælps Fond

socialeretshjaelp.dk

0
Non-profitDenmarksmallMEDIUM

Den Sociale Retshjælps Fond is a Danish non-profit organization dedicated to providing free legal aid and debt counseling services across Denmark. The website clearly targets Danish citizens seeking assistance with legal and financial issues, positioning itself as a trusted social aid foundation. The business model revolves around offering free advisory services, supported by a consistent brand presence and active social media engagement. The website's content is relevant and professionally presented, supporting its mission effectively. Technically, the website is built on WordPress using a modern stack including Elementor for design, Yoast SEO for optimization, and Cookiebot for cookie consent management. Hosting appears to be provided by One.com, and the site demonstrates moderate performance with good mobile optimization. Accessibility features are basic but present, and SEO practices are well implemented. From a security perspective, the site employs HTTPS and includes a cookie consent mechanism, enhancing privacy compliance. The presence of security plugins like Stop User Enumeration indicates awareness of security best practices. However, the absence of explicit security headers and a privacy policy page suggests room for improvement. No vulnerabilities or exposed sensitive data were detected in the analyzed content. Overall, the website presents a solid risk profile with a good security posture and trustworthy business legitimacy. Strategic recommendations include adding comprehensive privacy and terms of service pages, enhancing security headers, and publishing a vulnerability disclosure policy to further strengthen compliance and trust.

15
83
2
85
65
85
100
legalaiddebtcounselingnon-profitdenmarkfreelegalhelp+1 more
WordPressYoast SEOElementorjQuery+9
2025-06-23T19:08:09.096Z