Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 107 of 256|Showing 5301-5350 of 12794
S

SIA Petrow

petroff.lv

0
OtherLatviasmallHIGH

SIA Petrow is a Latvian legal services firm specializing in insolvency, civil and criminal law, crisis asset management, and legal support for investment projects. The firm positions itself as a leader in these legal domains within Latvia, targeting both individual and corporate clients. Their website presents a professional image with multilingual content in Latvian, Russian, and English, highlighting their key services and successful case outcomes. Contact information including a physical address, phone number, and email is clearly provided, enhancing business credibility. Technically, the website is built on WordPress using common plugins such as WPBakery Page Builder and Contact Form 7. It employs modern web technologies including HTTPS, jQuery, and Font Awesome icons. The site is mobile-optimized and demonstrates good SEO practices, though accessibility features are basic. Performance is moderate, with no critical technical issues detected. From a security perspective, the site enforces HTTPS but lacks visible security headers and does not provide a privacy or cookie policy, which are important for GDPR compliance. No incident response or vulnerability disclosure information is present. Tracking scripts from Facebook and ShareThis are used, indicating moderate user tracking. The absence of WHOIS data due to query limits limits domain trust analysis, but the website content and contact details suggest legitimacy. Overall, the website is professional and functional with room for improvement in privacy compliance and security best practices. Strategic recommendations include adding privacy and cookie policies, implementing security headers, and publishing incident response contacts to enhance trust and compliance.

15
25
17
70
72
75
20
legallawfirminsolvencycivillawcriminallaw+2 more
WordPressjQueryWPBakery Page BuilderContact Form 7+4
2025-07-30T16:00:26.180Z
mvtranspoint.com favicon

MV Transpoint

mvtranspoint.com

0
TransportationLatviasmallMEDIUM

MV Transpoint is a Latvia-based logistics company specializing in warehousing, cargo storage, and road transport services across Baltic and EU countries. With over 15 years of experience, the company positions itself as a reliable and loyal partner offering comprehensive logistics solutions including product issue and consultations. The website reflects a professional business with clear service offerings and client testimonials, targeting businesses requiring efficient logistics support. Technically, the website is built on WordPress using Elementor, integrated with Google Analytics and Facebook Pixel for marketing and tracking. The site is mobile-optimized and demonstrates good SEO practices, though performance is moderate. Security posture is adequate with HTTPS enabled and secure forms, but lacks advanced security headers and explicit security policies. Overall, the security posture is solid but could be improved by enabling DNSSEC, adding security headers, and publishing incident response information. Privacy compliance is basic with privacy and cookie policies present and consent mechanisms implemented. The domain WHOIS data is consistent with the business claims, enhancing trustworthiness. Strategically, MV Transpoint should focus on enhancing security transparency and compliance documentation to strengthen trust and meet evolving regulatory requirements. The website serves as a credible digital front for the company’s logistics services with room for technical and security enhancements.

72
60
85
20
73
2
20
logisticswarehousingtransportcargostorageroadtransport+3 more
WordPressElementorGoogle AnalyticsFacebook Pixel+1
2025-07-30T16:00:26.150Z
keepmybag.lv favicon

Keep my bag

keepmybag.lv

0
HospitalityLatviasmallHIGH

Keep My Bag operates an automated luggage storage service located in the heart of Riga's Old City Center, targeting travelers and tourists seeking secure and convenient luggage storage solutions. The website presents a professional and user-friendly interface with clear descriptions of services, pricing, and contact information. The business model revolves around renting automated lockers with PIN access, providing a hands-free experience for customers exploring Riga. Technically, the website is built on WordPress and integrates Google Analytics, Google Tag Manager, and Google Maps API for tracking and location services. The site is mobile-optimized with responsive design and uses modern web fonts. However, there is no evidence of advanced security headers or explicit privacy and cookie policies, which are important for compliance and user trust. From a security perspective, the site uses HTTPS (implied by URLs), but lacks visible security headers and formal privacy or incident response policies. No forms collecting sensitive data were found, reducing immediate risk exposure. The absence of WHOIS data limits domain legitimacy verification, but the website content and contact details appear consistent with a legitimate small business. Overall, the website scores moderately well in content quality, business credibility, and technical implementation but falls short in privacy compliance and security best practices. Strategic improvements in privacy policy publication, security headers implementation, and WHOIS transparency would enhance trust and compliance.

15
10
2
70
72
75
-
luggagestoragerigaautomaticlockertravelservicesecurestorage
Google AnalyticsGoogle Tag ManagerGoogle Maps APIMontserrat font from Google Fonts
2025-07-30T16:00:26.148Z
it-line.lv favicon

IT-Line

it-line.lv

0
TelecommunicationsLatviasmallHIGH

IT-Line is a Latvian internet service provider offering a range of telecommunications services including internet connectivity, internet salon services, and technical support primarily targeting commercial clients and residential users in the Daugavgrīva area. The website content is primarily in Latvian with some Russian language options, reflecting its local market focus. The business model centers on providing internet and related services to a regional customer base. The site is small-scale and uses legacy web technologies such as jQuery 1.7.2 and Cufon font replacement, indicating limited recent modernization efforts. From a technical perspective, the website employs basic HTML and JavaScript with no detected modern CMS or frameworks. Performance and mobile optimization are basic, and SEO features are minimal. The site uses HTTPS for its email login form but does not show evidence of comprehensive security headers or modern security best practices. The absence of privacy and cookie policies indicates a gap in compliance with GDPR and related regulations. Security posture is moderate to low, with outdated libraries posing potential vulnerabilities and no visible security policies or incident response contacts. The lack of WHOIS data due to query limits restricts full domain legitimacy assessment, but the site content and structure align with a legitimate small ISP business. Overall, the site is safe for general audiences but requires improvements in security, privacy compliance, and technical modernization. Strategic recommendations include updating the technology stack, implementing security headers, adding privacy and cookie policies, enhancing contact transparency, and improving SEO and accessibility to strengthen trust and compliance.

20
25
2
60
62
70
20
internetservicesisplatviatelecommunicationssmallbusiness
jQuery 1.7.2Cufon font replacement
2025-07-30T16:00:25.997Z
travelventspils.lv favicon

Brīvdienu māja PODNIEKI

travelventspils.lv

0
HospitalityLatviasmallMEDIUM

The website travelventspils.lv represents a small family-friendly guest house named Brīvdienu māja PODNIEKI located in Ventspils, Latvia. The business focuses on hospitality services catering primarily to families with children and tourists visiting the region. The site provides accommodation booking information primarily via phone and WhatsApp, with additional tourist information links to the official Ventspils tourism site. The market position is local and niche, targeting visitors seeking a family-oriented stay in Ventspils. Technically, the website is built on the Mozello CMS platform and leverages Amazon CloudFront CDN for content delivery. It uses legacy JavaScript libraries such as jQuery 2.2.4 and plugins like Fancybox3 for UI components. The site is moderately optimized for mobile devices and has basic SEO and accessibility features. However, there is no evidence of advanced frameworks or modern JavaScript technologies. From a security perspective, the site lacks visible security headers and privacy or cookie policies, which are critical for GDPR compliance given its European location. No WHOIS data was retrievable due to query limits, limiting domain legitimacy verification. The site uses HTTPS (implied by canonical URL) but lacks explicit security best practices such as CSP or HSTS headers. Contact information is limited to phone numbers without email or contact forms, reducing attack surface but also limiting user engagement options. Overall, the website is functional and appropriate for its business purpose but shows gaps in privacy compliance and security hardening. The absence of WHOIS data and privacy policies reduces trustworthiness from a compliance standpoint. Strategic improvements in security headers, privacy documentation, and WHOIS transparency would enhance the site's credibility and compliance posture.

20
10
2
60
75
75
100
hospitalityguesthousefamilyfriendlyventspilslatvia+2 more
jQuery 2.2.4Fancybox3BannerplayResponsiveVideos+1
2025-07-30T16:00:25.993Z
jahtas.eu favicon

SIA BOFORS

jahtas.eu

0
TransportationLatviasmallMEDIUM

Jahtas.lv, operated by SIA BOFORS, is a well-established Latvian company specializing in the sale and servicing of new and used watercraft since 2006. The company offers a comprehensive range of services including boat sales, winter storage, summer mooring, equipment sales, engine maintenance, hull repairs, and other boat management services. Positioned as a local leader in the water transport sector, Jahtas.lv targets boat owners and maritime enthusiasts primarily in Latvia. The website reflects a professional business with clear contact information and a detailed FAQ section, supporting customer engagement and trust. Technically, the website is built on WordPress using popular plugins such as Elementor and Revolution Slider, with SEO optimization via Rank Math and analytics through Google Analytics. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and security header implementation. Hosting is managed through GoDaddy, a reputable registrar and hosting provider. From a security perspective, the site uses HTTPS and includes reCAPTCHA for form protection, but lacks explicit security headers and published security policies. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is limited due to the absence of privacy and cookie policies, which is a notable compliance gap. Overall, the security posture is moderate but could be enhanced with additional measures. The overall risk assessment indicates a legitimate and trustworthy business with minor compliance and security improvements recommended. Strategic focus should be on enhancing privacy compliance, implementing security headers, and publishing incident response and vulnerability disclosure information to strengthen trust and regulatory adherence.

100
75
40
75
2
15
10
boatsyachtswatercraftmarineservicesboatsales+2 more
WordPressElementorRevolution SliderjQuery+5
2025-07-30T16:00:25.974Z
hotelstelles.lv favicon

SIA GIK

hotelstelles.lv

0
HospitalityLatviasmallMEDIUM

Hotel Stelles, operated by SIA GIK, is a small hospitality business located in Tukums, Latvia, specializing in group accommodation and event space rental for up to 50 people. The website offers detailed information about their rooms, event halls, and catering options, targeting groups and business clients seeking comfortable lodging and venues for seminars, banquets, and social gatherings. The business maintains a local market position with clear contact channels and social media presence, enhancing customer engagement and trust. Technically, the website is built on the MultiScreenSite platform, utilizing modern web technologies including jQuery, Google Analytics, Google Tag Manager, and service workers for PWA capabilities. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features are basic, and security headers are not explicitly detected, though HTTPS is properly enforced. From a security perspective, the site employs Google reCAPTCHA on its reservation form to mitigate spam and abuse. No critical vulnerabilities or exposed sensitive data were found. Privacy compliance is partial; a privacy policy is present but lacks a cookie consent mechanism, which is recommended for GDPR adherence. WHOIS data could not be retrieved due to query limits, limiting domain registration verification. Overall, Hotel Stelles presents a professional and trustworthy online presence suitable for its hospitality niche. Strategic improvements in privacy compliance and security headers would enhance its security posture and regulatory adherence.

100
60
75
72
17
10
70
hospitalityhoteleventspacegroupaccommodationlatvia+4 more
jQuery 3.7.0Google Analytics (gtag.js)Google Tag ManagerPhotoswipe+3
2025-07-30T16:00:25.972Z
tara24.lv favicon

TARA24.LV stikla burku un pudeļu tirdzniecība

tara24.lv

0
RetailLatviasmallHIGH

TARA24.LV is a Latvian-based small retail and wholesale business specializing in glass jars, bottles, and related packaging products. The company operates an e-commerce website built on the PrestaShop platform, offering a broad assortment of glass packaging solutions to customers primarily in the Baltic region. The website is professionally designed with clear navigation and product categorization, targeting both retail consumers and business clients. Contact information and business registration details are clearly presented, supporting business credibility. Technically, the website leverages modern web technologies including Google Tag Manager and Google Analytics for marketing and analytics purposes. The site is mobile-optimized and performs moderately well, though some accessibility features could be improved. Security posture is adequate with HTTPS enforced, but lacks several important HTTP security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, no major vulnerabilities or exposed sensitive data were detected. However, the absence of security headers and formal privacy compliance mechanisms suggest moderate risk. The WHOIS data could not be retrieved due to query limits, limiting domain registration verification. Overall, the website appears legitimate and trustworthy for its business scope but would benefit from enhanced security and privacy practices. Strategic recommendations include implementing comprehensive privacy and cookie policies, adding security headers, publishing a security.txt file for vulnerability disclosure, and improving accessibility compliance. These steps would strengthen the site's security posture, regulatory compliance, and user trust.

70
62
20
75
20
2
10
e-commerceretailglasspackagingprestashoplatvia
PrestaShop CMSGoogle Tag ManagerGoogle AnalyticsjQuery+2
2025-07-30T16:00:25.968Z