Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 134 of 206|Showing 6651-6700 of 10254
V

Visvere Inc.

visvere.com

0
TechnologyUnited StatessmallMEDIUM

Visvere Inc. is a newly founded technology company (2024) specializing in digital document authentication and integrity solutions. Their platform targets businesses and regulatory bodies that require tamper-proof verification of critical digital documents to prevent fraud and ensure trust. Key services include cyber audits, carbon capture verification, food supply chain integrity, and due diligence partnerships. The company positions itself as a trusted provider addressing billion-dollar problems related to digital forgery and fraud. Technically, the website is hosted behind Cloudflare DNS, uses HTTPS, and integrates Google Tag Manager for analytics. The site is professionally designed with good mobile optimization and clear navigation, although accessibility features are basic. Security posture is solid with HTTPS and domain transfer protection, but could be improved by enabling DNSSEC and publishing security headers and policies. Privacy compliance is basic with a privacy and cookie policy present but no explicit GDPR statements or terms of service. Contact information is clearly provided with a company email and physical address in the USA. Overall, the website and domain registration are consistent with a legitimate startup business with a focus on secure digital verification services.

30
83
47
55
75
70
100
digitalauthenticationdocumentverificationcyberauditcarboncapturefoodsupplychain+3 more
Google Tag ManagerCloudflare DNSTypekit FontsCustom CSS and JS
2025-07-07T10:12:02.160Z
rulegarza.com favicon

Rule Garza Howley LLP

rulegarza.com

0
GovernmentUnited StatessmallMEDIUM

Rule Garza Howley LLP is a specialized boutique law firm based in Washington, DC, focusing on antitrust legal services. The firm leverages over four decades of experience and a team of former senior antitrust officials to provide sophisticated advice and representation in high-profile matters involving government agencies such as the DOJ and FTC. Their client base primarily consists of multinational corporations requiring expert counsel on M&A, government investigations, and litigation. The firm positions itself as a nimble, responsive, and client-focused legal service provider with a strong market reputation. Technically, the website is built on WordPress and employs modern web technologies including jQuery, Google Analytics, Facebook SDK, and SEO plugins like Yoast. The site is mobile-optimized with good navigation and professional design, reflecting a mature digital presence. Performance is moderate, with room for improvement in accessibility and SEO enhancements. From a security perspective, the site uses HTTPS and integrates standard analytics and social media SDKs securely. However, it lacks explicit security headers and published security or incident response policies. Privacy compliance is minimal, with no visible privacy or cookie policies, which is a notable gap given the data collection via analytics and subscription forms. The WHOIS data is missing or inaccessible, which raises concerns about domain registration transparency despite the professional website content. Overall, the website presents a credible and professional front for the law firm but should address privacy compliance and domain registration transparency to enhance trust and security posture.

15
35
17
75
52
75
100
lawfirmantitrustlegalserviceswashingtondcprofessionalservices
jQueryGoogle AnalyticsFacebook SDKYoast SEO+4
2025-07-07T10:09:01.398Z
wrightclosebarger.com favicon

Wright Close & Barger, LLP

wrightclosebarger.com

0
OtherUnited StatessmallMEDIUM

Wright Close & Barger, LLP is a specialized Texas law firm focusing on complex civil litigation, including trial and appellate work. The firm has over 20 years of experience and is recognized for its appellate expertise, serving clients across Texas in areas such as personal injury, insurance, commercial disputes, intellectual property, and oil and gas. The website presents a professional image with clear branding and contact information, targeting legal clients seeking high-quality representation. Technically, the website is built on WordPress using the PaperStreet theme and incorporates modern JavaScript libraries such as jQuery, Slick Carousel, and Lozad for lazy loading. It uses Google Analytics and Google Tag Manager for tracking and SEO is enhanced with the Yoast SEO plugin. Hosting appears to be via WP Engine, a reputable managed WordPress host. The site is mobile optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks important security headers and does not display cookie consent or privacy banners, which may impact compliance with privacy regulations. The absence of WHOIS data for the domain is a notable concern, reducing trust in domain legitimacy despite the professional website content. Overall, the site is a credible and professional legal services platform with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain ownership and legitimacy.

15
35
2
70
52
80
100
lawfirmlegalservicesappellateattorneystrialattorneystexas+1 more
WordPressjQueryGoogle AnalyticsYoast SEO+2
2025-07-07T10:08:51.381Z
klopp.law favicon

Klopp Law

klopp.law

0
OtherUnited StatessmallMEDIUM

Klopp Law is a veteran-owned criminal defense law firm based in Reading, Pennsylvania, specializing in defending clients against serious criminal charges such as drug offenses, gun cases, assaults, and DUI. The firm positions itself as a dedicated and aggressive advocate for clients in eastern Pennsylvania, emphasizing personalized legal representation and thorough case preparation. The website reflects a small but professional legal practice with a clear focus on criminal defense services. Technically, the website is built on WordPress using the PaperStreet theme framework, incorporating modern web technologies such as jQuery, Swiper.js for sliders, and lazy loading for images. SEO is well addressed with Yoast SEO plugin integration and proper meta tags. The site is mobile optimized and provides a good user experience with clear navigation and professional design. Hosting is likely through GoDaddy, consistent with the domain registrar information. From a security perspective, the site uses HTTPS and does not expose sensitive data in the HTML. However, it lacks DNSSEC, visible security headers, and dedicated security or incident response policies. Privacy compliance is weak due to the absence of privacy and cookie policies or consent mechanisms. The domain WHOIS data is consistent with the business claims, showing no privacy protection and a legitimate registration history. Overall, Klopp Law's website is a solid representation of a small legal practice with good business credibility and technical implementation but requires improvements in privacy compliance and security best practices to enhance trust and regulatory adherence.

15
35
2
70
52
75
100
legalcriminaldefenselawfirmpennsylvaniaveteran-owned+1 more
WordPressYoast SEO pluginjQuerySwiper.js+3

Partner Domains:

clients.clio.com
partner
app.clio.com
partner

+2 more partners

2025-07-07T10:08:46.369Z
mgwl.com favicon

McGill Gotsdiner Workman & Lepp P.C. L.L.O.

mgwl.com

0
OtherUnited StatesmediumMEDIUM

McGill Gotsdiner Workman & Lepp P.C. L.L.O. is a well-established Nebraska-based law firm specializing in corporate, business, estate planning, health care, employment, litigation, and real estate legal services. The firm targets entrepreneurs and businesses seeking comprehensive legal counsel and has been operating since 1975, positioning itself as a trusted regional legal service provider. The website reflects a professional and client-focused approach with detailed attorney profiles and multiple practice areas. Technically, the site is built on WordPress and leverages modern web technologies including Google Analytics, Google Tag Manager, and reCAPTCHA for security on contact forms. The site is mobile optimized and demonstrates good SEO practices with structured data markup. Security posture is solid with HTTPS enforced and use of CAPTCHA, though explicit security headers are not detected, and privacy compliance could be improved with cookie consent mechanisms. The absence of WHOIS registration data is a notable inconsistency that slightly impacts trust but does not overshadow the professional presentation and content quality. Overall, the website is a credible digital presence for a mid-sized law firm with room for enhancement in privacy and security transparency.

15
35
17
75
52
80
100
lawlegalcorporatebusinessestateplanning+5 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA v3+2

Partner Domains:

www.lawfirmessentials.com
partner
www.paperstreet.com
partner
2025-07-07T10:08:41.355Z
crossandsmith.com favicon

Cross & Smith LLC

crossandsmith.com

0
OtherUnited StatessmallMEDIUM

Cross & Smith LLC is a well-established personal injury law firm operating primarily in Alabama with offices in Tuscaloosa and Birmingham. The firm specializes in accident and injury cases, boasting over 25 years of experience and significant verdicts and settlements exceeding $150 million. Their business model is client-focused with a contingency fee structure, targeting individuals seeking legal representation for personal injury matters. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, supporting a strong market position in the regional legal services sector. Technically, the website is built on WordPress using a custom theme by PaperStreet, incorporating modern web technologies such as Yoast SEO for search optimization, Google reCAPTCHA for form security, and CallRail for call tracking. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, some accessibility features are basic and there is room for improvement in performance and security headers. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms from spam. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security headers like HSTS and CSP, and the lack of a published security or incident response policy, indicate areas for enhancement. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism or GDPR-specific disclosures. Overall, the website is trustworthy and professional, with a solid business credibility score. Strategic improvements in privacy compliance, security header implementation, and incident response transparency would further strengthen the firm's digital security posture and regulatory adherence.

15
35
17
70
42
75
100
personalinjurylawfirmlegalservicesalabamaattorneys+2 more
WordPressYoast SEOFontAwesomeGoogle reCAPTCHA+2
2025-07-07T10:08:16.290Z
registerplanninglaw.com favicon

Register Law, LLC

registerplanninglaw.com

0
Real EstateUnited StatessmallMEDIUM

Register Law, LLC is a small legal services firm specializing in estate and business planning, trust administration, and prenuptial agreements. The firm positions itself as a thoughtful and personalized planning service provider, emphasizing the client's identity and legacy beyond tax considerations. The website reflects a professional and consistent brand image targeting individuals and businesses in the United States seeking legal planning services. Technically, the website is built on WordPress and uses common web technologies such as jQuery, Google Analytics, and Font Awesome. The site is mobile optimized with good SEO practices but lacks some accessibility features and security headers. Security posture is generally good with HTTPS enforced and no visible vulnerabilities, but the absence of security headers and privacy compliance mechanisms are notable gaps. The WHOIS data is missing, which raises concerns about domain legitimacy and registration status, although the website content and presentation suggest a legitimate business. Contact information is clearly provided with multiple physical addresses and verified company emails and phone numbers. Overall, the website scores moderately well but would benefit from improved privacy compliance and enhanced security practices.

15
35
17
70
72
75
100
estateplanningbusinessplanningtrustadministrationprenuptialagreementslegalservices+1 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle WebFont Loader+1
2025-07-07T10:08:11.280Z
ffslawfirm.com favicon

Fridman Fels & Soto, PLLC

ffslawfirm.com

0
FinanceUnited StatessmallMEDIUM

Fridman Fels & Soto, PLLC is a boutique law firm specializing in white collar criminal defense, securities litigation, and complex investigations, primarily serving U.S. and Latin American clients. Founded in 2019 by former federal prosecutors, the firm emphasizes personalized client service and expertise in criminal and commercial law. Their market position is that of a specialized, trusted legal service provider with a strong reputation bolstered by client testimonials and industry citations. Technically, the website is built on WordPress with a modern tech stack including Bootstrap, WPBakery Page Builder, and Slider Revolution. Hosting appears to be via WP Engine, ensuring reliable performance. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Analytics and marketing tools such as Google Analytics and HubSpot are integrated, indicating moderate user tracking. From a security standpoint, the site uses HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled and no explicit security headers were detected, suggesting room for improvement. Privacy compliance is weak due to the absence of visible privacy and cookie policies. No incident response or vulnerability disclosure information is published. Overall, the website presents a professional and trustworthy image with good business credibility but could enhance its privacy and security posture to meet higher compliance standards.

15
50
17
60
75
80
100
lawfirmwhitecollardefenselitigationmiamilegalservices+2 more
WordPressPHPjQueryBootstrap+5
2025-07-07T10:07:46.145Z
younglegalpllc.com favicon

Young Legal, PLLC

younglegalpllc.com

0
Real EstateUnited StatessmallMEDIUM

Young Legal, PLLC is a small law firm based in North Carolina specializing in business law, real estate, and litigation services. The firm targets individuals and businesses primarily in the Raleigh-Durham area, offering legal representation, strategic counsel, and flexible payment options including monthly subscription plans and personal injury consultations. The website presents a professional and consistent brand image with clear contact information and client testimonials, positioning the firm as a trustworthy local legal service provider. Technically, the website is built on WordPress using the PaperStreet theme, hosted on Bluehost, and incorporates modern web technologies such as Google Analytics and Font Awesome. While the site is mobile-optimized and performs moderately well, there are areas for improvement in accessibility and SEO. Security-wise, the site uses HTTPS and domain locks but lacks DNSSEC and important security headers, and does not provide a security policy or incident response information. Privacy compliance is limited, with no cookie consent mechanism and only a basic privacy/disclaimer page. Overall, the website is functional and credible but would benefit from enhanced security and privacy features to improve trust and compliance.

20
35
2
85
72
50
100
lawfirmlegalservicesbusinesslawrealestatelawlitigation+3 more
Google AnalyticsGoogle Tag ManagerjQuerySlick Slider+2

Partner Domains:

secure.lawpay.com
partner
lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:10.979Z
salazar.law favicon

Salazar Law

salazar.law

0
FinanceUnited StatessmallMEDIUM

Salazar Law is a specialized boutique law firm based in Miami, Florida, focusing on high-stakes financial restructuring, litigation, cryptocurrency-related legal challenges, and government investigations. The firm has a strong market position with over $1 billion in judgments and settlements and over $10 billion in debt restructured, serving businesses and individuals with complex legal needs. Their key services include strategic restructuring, high-stakes litigation, and cryptocurrency litigation and recovery. The website reflects a professional and consistent brand image targeting business clients in the finance and legal sectors. Technically, the website employs modern web technologies including Google Analytics, Google Tag Manager, Google reCAPTCHA, and the Foundation CSS framework. The site is mobile optimized with good navigation and SEO practices, though performance is moderate. Security posture is solid with HTTPS enforced and use of reCAPTCHA, but lacks some security headers and explicit privacy and cookie policies, which are areas for improvement. From a security perspective, the site shows no critical vulnerabilities or exposed sensitive data. However, the absence of privacy and cookie policies and incident response information indicates compliance gaps. The WHOIS data is unavailable, likely due to privacy protection, which is common and justified for law firms. Overall, the site is trustworthy and professional but would benefit from enhanced transparency and security best practices. Strategically, the firm should prioritize publishing comprehensive privacy and cookie policies, implement security headers, and provide incident response and vulnerability disclosure information to strengthen compliance and trust. Enhancing accessibility and performance would further improve user experience and SEO effectiveness.

30
35
2
70
67
70
100
lawlegalfinancialrestructuringlitigationcryptocurrency+2 more
Google AnalyticsGoogle Tag ManagerGoogle reCAPTCHAjQuery+2

Partner Domains:

secure.lawpay.com
partner
www.lawfirmessentials.com
partner

+1 more partners

2025-07-07T10:07:05.970Z
sunsetblvdinv.com favicon

Sunset Blvd. Investigations Inc.

sunsetblvdinv.com

0
OtherUnited StatessmallMEDIUM

Sunset Blvd. Investigations Inc. is a small, privately owned private investigation firm based in Los Angeles, California, with an additional office in Newport Beach. Founded in 2015, the company leverages over 80 years of combined law enforcement and investigative experience from its founders, who served as detectives in the LAPD and LASD. The firm offers a comprehensive suite of investigative services including surveillance, background checks, litigation support, and executive protection, targeting individuals and businesses requiring professional investigative assistance locally and globally. The website is professionally designed, mobile-optimized, and provides clear navigation and detailed service descriptions, enhancing user experience and trust. Technically, the website is built on WordPress using a PaperStreet theme, employing modern web technologies such as jQuery and Google reCAPTCHA for form security. The site enforces HTTPS, ensuring secure communications, but lacks some recommended security headers which could improve its security posture. Privacy compliance is partially addressed with a comprehensive privacy policy, though cookie policy and consent mechanisms are absent. Contact information is prominently displayed with multiple phone numbers and physical addresses, supporting business credibility. Security-wise, the site demonstrates good practices such as HTTPS and CAPTCHA protection on forms, but could benefit from enhanced security headers and published incident response policies. The absence of WHOIS data for the domain is a notable concern, reducing domain trustworthiness despite the professional appearance and content of the website. Overall, the site presents a trustworthy and professional front for a specialized investigative service provider, with room for improvement in security and privacy transparency.

15
53
17
70
52
75
100
privateinvestigatorlosangelesinvestigationslawenforcementsurveillance+2 more
jQuery 3.7.1Font: Roboto WOFF2Slick SliderYoast SEO (implied by Yoast schema)+1
2025-07-07T10:07:00.960Z
districtedc.com favicon

District E Powered by Ticketmaster

districtedc.com

0
HospitalityUnited StatessmallMEDIUM

District E Powered by Ticketmaster is a specialized live-event venue located in downtown Washington, D.C., focusing primarily on esports and entertainment events. The venue is positioned as a premier destination adjacent to the Capital One Arena, targeting esports enthusiasts and entertainment consumers in the region. The business model revolves around hosting live esports competitions, entertainment shows, and private events, leveraging Ticketmaster's ticketing platform for event management. The website reflects a professional and consistent brand image aligned with its market positioning. Technically, the website is built on the Squarespace platform, utilizing modern web technologies including Google Tag Manager, Facebook Pixel, and OneTrust for cookie consent management. The site is SSL secured with HSTS enabled, indicating a strong baseline security posture. Performance and mobile optimization are adequate, with good SEO practices observed. However, accessibility features are basic and could be improved. From a security perspective, the site enforces HTTPS and includes security headers such as HSTS. Cookie consent is implemented via OneTrust, supporting GDPR compliance. However, the absence of a published privacy policy, terms of service, and incident response contact information represents compliance and transparency gaps. No WHOIS data was found for the domain, which raises concerns about domain registration legitimacy and should be investigated further. Overall, the website presents a trustworthy and professional front for the business but requires enhancements in privacy compliance documentation and domain registration transparency. Strategic recommendations include publishing comprehensive privacy and terms policies, establishing a vulnerability disclosure or security contact page, and verifying domain registration details to strengthen trust and compliance.

45
88
17
60
62
75
100
esportsentertainmentliveeventsticketmasterwashingtondc+2 more
Squarespace CMSGoogle Tag ManagerFacebook PixelOneTrust Cookie Consent+1

Partner Domains:

monumentalsports.com
partner
ticketmaster.com
partner
2025-07-07T10:06:25.814Z
S

Synacor, Inc.

auth-gateway.net

0
TechnologyUnited StatesmediumMEDIUM

The domain auth-gateway.net is registered to Synacor, Inc., a US-based technology company established in 2012. However, the website currently serves only a 404 Not Found error page with no accessible content, metadata, or interactive elements. This lack of content severely limits the ability to assess the business's online presence or service offerings. The domain registration details are consistent and legitimate, but the absence of website content negatively impacts user trust and engagement. From a technical perspective, no technologies, frameworks, or hosting details beyond DNS servers are detectable. There is no evidence of HTTPS or security headers, which raises concerns about the security posture if the site were live. No privacy, cookie, or terms of service policies are present, indicating non-compliance with common privacy regulations such as GDPR. Security evaluation is constrained by the lack of content and headers. No vulnerabilities or security best practices can be confirmed. The domain itself appears legitimate, but the website's current state suggests it is either under development, deprecated, or misconfigured. This represents a risk for users expecting a functional service. Overall, the site scores very low on content quality, technical implementation, security posture, and privacy compliance. Strategic recommendations include restoring website content, implementing HTTPS and security headers, publishing privacy and cookie policies, and providing clear contact and incident response information to improve trust and compliance.

15
50
17
70
82
75
100
2025-07-07T10:06:05.763Z
livebooks.com favicon

liveBooks

livebooks.com

0
TechnologyUnited StatessmallMEDIUM

liveBooks is a specialized website builder platform targeting creative professionals such as photographers, artists, and real estate agents. Established in 2005, the company offers customizable website templates, SEO tools, video galleries, and customer support, positioning itself as a niche leader in the creative website building market. The website emphasizes ease of use, mobile-friendly design, and professional presentation, supported by client testimonials and a 14-day free trial to attract users. Technically, the website employs a modern but somewhat dated technology stack including jQuery 1.12.4, Bootstrap 4.2.1, Google Analytics, and Typekit fonts. Hosting and domain registration are managed through Amazon Registrar, Inc., indicating reliable infrastructure. The site is mobile-optimized with good SEO practices but lacks some advanced accessibility features and security headers. From a security perspective, the site uses HTTPS and domain registration locks to protect domain integrity. However, it lacks DNSSEC, explicit security headers, and a cookie consent mechanism, which are areas for improvement. No vulnerability disclosures or incident response contacts are found, indicating limited transparency in security operations. Overall, liveBooks presents a professional and trustworthy online presence with solid business credibility and technical implementation. The main risks relate to privacy compliance and security best practices, which if addressed, could enhance user trust and regulatory adherence.

15
58
17
80
62
85
100
websitebuilderphotographycreativeprofessionalsportfolioseo+1 more
jQuery 1.12.4Bootstrap 4.2.1Google AnalyticsTypekit fonts+1
2025-07-07T10:05:50.714Z
whova.com favicon

Whova

whova.com

0
TechnologyUnited StatesmediumMEDIUM

Whova is a well-established technology company founded in 2012, specializing in providing an all-in-one event management platform that supports in-person, hybrid, and virtual events. Their platform includes award-winning event apps, registration and ticketing software, event management tools, marketing solutions, and exhibitor management. The company targets a broad range of event organizers including corporate, academic, government, association, and trade show sectors. Whova has a strong market position supported by industry awards, customer testimonials, and press coverage. Technically, the website is built on WordPress using the Divi theme and leverages modern web technologies including jQuery, Google Fonts, and YouTube APIs. Hosting is via AWS infrastructure, and the site demonstrates good performance, mobile optimization, and SEO practices. Privacy and cookie compliance are robust, with a clear cookie consent mechanism and comprehensive privacy policies. From a security perspective, the site uses HTTPS with good SSL configuration but lacks DNSSEC and some advanced security headers. No vulnerabilities or exposed sensitive data were detected. However, the absence of a public incident response or vulnerability disclosure policy is noted. Overall, the security posture is solid but could be improved with additional transparency and DNS security. The website is professional, trustworthy, and safe for general audiences. It employs extensive user tracking for analytics and marketing purposes but maintains GDPR compliance. Contact information is clearly provided, including a company email and phone number. Social media presence on Twitter and LinkedIn supports engagement and trust. Strategic recommendations include enabling DNSSEC, adding security headers, publishing incident response and vulnerability disclosure information, and continuing to enhance privacy transparency to maintain and improve trust and security posture.

70
80
2
85
67
90
100
eventmanagementeventappeventregistrationhybrideventsvirtualevents+3 more
WordPressDivi ThemejQueryYouTube iframe API+6
2025-07-07T09:02:44.772Z
F

Federal Reserve Bank of St. Louis

askthefed.org

0
FinanceUnited StatesenterpriseMEDIUM

Ask the Fed® is an educational program operated by the Federal Reserve Bank of St. Louis, providing financial and regulatory updates to bankers and their boards through webinars and conference calls. The website serves as a login portal for registered users to access these resources. The business operates under the Federal Reserve System umbrella, positioning itself as a trusted authority in the finance sector. The content is professional, targeted, and consistent with the Federal Reserve's branding and mission. Technically, the website uses a modern but somewhat dated tech stack including AngularJS, jQuery, and Bootstrap. The site is moderately optimized for performance and mobile use, though accessibility features appear basic. Security practices include use of anti-forgery tokens and secure form submission, but visible security headers and cookie consent mechanisms are lacking. The WHOIS data is unavailable due to privacy or query failure, but the domain is a subdomain of a legitimate Federal Reserve domain, supporting its authenticity. Security posture is moderate with room for improvement in headers and transparency around incident response. No vulnerabilities or malicious content were detected. Privacy compliance is good with a clear privacy policy and contact information, though cookie consent is missing. Overall, the site is trustworthy and professionally maintained, suitable for its audience. Risk is low but recommendations include enhancing security headers, adding cookie consent, and publishing security policies to improve compliance and trust further.

55
53
17
70
95
85
100
financebankingfederalreservewebinarlogin+2 more
jQueryBootstrapAngularJSModernizr
2025-07-07T08:59:43.496Z
B

Board of Governors of the Federal Reserve System

fedpartnership.gov

0
FinanceUnited StateslargeMEDIUM

The website www.fedpartnership.gov represents the Partnership for Progress program, a Federal Reserve System initiative aimed at supporting minority-owned and de novo banking institutions. The site provides educational resources, guidance, and regulatory information to help these institutions thrive in a competitive financial environment. It is positioned as a niche government program with a clear focus on minority banking within the United States. The content is professionally presented with consistent branding aligned with the Federal Reserve, targeting minority banks, entrepreneurs, and financial professionals. Technically, the website employs basic JavaScript and CSS technologies, including Google Tag Manager for analytics. The site lacks modern frameworks or CMS indications and shows moderate performance and basic mobile optimization. Accessibility features are minimal but present. Security posture is moderate with HTTPS implied but missing explicit security headers and no visible advanced security policies. Privacy compliance is basic, with a privacy policy linked but no cookie consent mechanism. Security-wise, the site shows no critical vulnerabilities or exposed sensitive data but would benefit from improved security headers and incident response disclosures. WHOIS data is incomplete or unavailable, likely due to government domain privacy or restrictions, which slightly reduces trust but does not detract from the site's legitimacy given its official Federal Reserve affiliation. Overall, the site is trustworthy, safe, and serves its informational purpose effectively.

45
53
2
70
85
80
100
governmentfinanceminority-ownedbankingfederalreserve+1 more
JavaScriptGoogle Tag ManagerGreybox JS
2025-07-07T08:59:38.480Z
B

Board of Governors of the Federal Reserve System

federalreserve.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The Board of Governors of the Federal Reserve System operates as the central bank of the United States, providing critical monetary policy, financial system oversight, and regulatory functions. The website serves as an authoritative source of information for policymakers, financial institutions, researchers, and the general public, offering extensive resources on monetary policy, supervision, financial stability, payment systems, and economic research. The Federal Reserve holds a dominant market position as the nation's central banking authority, delivering essential services that underpin the US financial system's safety and stability. Technically, the website employs a mature and robust infrastructure leveraging AngularJS, Bootstrap, and Modernizr, with Cloudflare Zaraz for tag management and tracking. The site is well-optimized for mobile devices, accessible, and demonstrates good SEO practices. Performance is moderate, consistent with the complexity and volume of content served. Security is strong, with HTTPS enforced, comprehensive security headers, and no visible vulnerabilities or exposed sensitive data. The security posture is commendable, reflecting best practices for a government entity. However, the absence of a public vulnerability disclosure program or security.txt file and limited incident response contact visibility represent areas for improvement. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR principles. Overall, the website is highly trustworthy, professionally maintained, and secure, supporting the Federal Reserve's mission. Strategic recommendations include enhancing public security communication channels, maintaining up-to-date third-party libraries, and implementing a formal vulnerability disclosure process to further strengthen security and transparency.

45
58
17
85
95
80
100
federalreserveusgovernmentfinancemonetarypolicybankingregulation+2 more
AngularJSBootstrap CSSModernizrVideoJS+1
2025-07-07T08:59:23.442Z
H

Holo Host

holo.host

0
TechnologyUnited StatessmallMEDIUM

Holo Host is a technology company specializing in community owned cloud hosting infrastructure tailored for Holochain and decentralized applications. The company positions itself as an ethical and sovereign alternative to traditional centralized cloud providers, targeting organizations and developers who prioritize data ownership, privacy, and freedom from big tech monopolies. Their key services include dedicated Holo Cloud Nodes and the Holo Web Bridge, enabling resilient and user-owned digital infrastructure. The business is affiliated with the Holochain Foundation and has been operational since 2017, with a small but focused market presence. Technically, the website employs modern JavaScript technologies, integrates Google Analytics with user consent, and uses Cloudflare DNS and Cloudfront for content delivery. The site is mobile optimized with good SEO practices and clear navigation. However, no major CMS or frameworks are detected, indicating a custom-built solution. Performance is moderate, and accessibility is basic but adequate. From a security perspective, the site enforces HTTPS and uses clientTransferProhibited status on the domain. Cookie consent mechanisms are implemented, but security headers are not explicitly detected, and no published security or incident response policies are found. The WHOIS data shows privacy protection but is consistent with the business profile and domain age. No vulnerabilities or suspicious patterns are evident. Overall, Holo Host demonstrates a solid digital maturity level with good privacy compliance and business credibility. Strategic improvements in security policy transparency and DNSSEC enablement could further enhance trust and resilience.

45
83
10
80
75
80
100
decentralizedhostingholochaincloudhostingdigitalsovereigntyethicaltechnology+2 more
JavaScriptGoogle Analytics (GA4)Cloudflare DNSEngageBay (marketing automation)+1

Partner Domains:

visvere.com
partner
hummhive.com
partner
2025-07-07T08:59:18.432Z
undergroundshirts.com favicon

Underground Printing

undergroundshirts.com

0
RetailUnited StateslargeMEDIUM

Underground Printing is a well-established custom apparel and promotional products company founded in 2001, operating primarily in the US retail sector. The company offers a wide range of services including screen printing, embroidery, digital printing, and heat transfer, targeting businesses, teams, fundraisers, and individuals. Their market position is strong, supported by a large product catalog, multiple physical locations, and a professional e-commerce platform. The website reflects a consistent brand image with excellent content quality and user experience, catering effectively to their target audience. Technically, the website leverages modern web technologies such as Vue.js and Vuetify, integrates with reputable third-party services like Stripe for payments, Klaviyo for marketing, and HelpScout for customer support. Hosting is provided via Amazon AWS infrastructure, ensuring reliable performance. The site is mobile-optimized and includes SEO best practices, although accessibility features could be improved. From a security perspective, the site enforces HTTPS and employs domain locking mechanisms to prevent unauthorized changes. However, DNSSEC is not enabled, and there is a lack of publicly available security policies or incident response information. The absence of privacy and cookie policies indicates a gap in privacy compliance, which could expose the company to regulatory risks. Overall, the website is professional, trustworthy, and functionally sound but would benefit from enhanced privacy compliance and explicit security disclosures to strengthen its security posture and regulatory adherence.

15
53
2
70
77
80
100
customapparelscreenprintingembroiderypromotionalproductse-commerce+1 more
Vue.jsVuetifyStripeKlaviyo+6
2025-07-07T08:59:08.370Z