Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 135 of 206|Showing 6701-6750 of 10254
hunton.com favicon

Hunton Andrews Kurth LLP

hunton.com

0
OtherUnited StateslargeMEDIUM

Hunton Andrews Kurth LLP is a well-established global law firm with over 120 years of history, serving clients primarily in the energy, financial services, real estate, and retail sectors. The firm operates through 18 offices worldwide and employs over 900 professionals. Their business model focuses on providing comprehensive legal services with a collaborative approach, targeting corporate clients and industries requiring specialized legal expertise. The website reflects a mature digital presence with professional design, clear navigation, and extensive content that supports their market position as a leading law firm. Technically, the website employs modern web technologies including Google Tag Manager for analytics and OneTrust for cookie consent management, indicating a commitment to privacy compliance and user experience. The site is mobile-optimized, accessible, and SEO-friendly, though no specific CMS or hosting provider was identified. Performance is moderate, with good use of modern image formats and SVG graphics. From a security perspective, the site uses HTTPS with strong SSL configuration and includes security headers, enhancing protection against common web threats. However, there is no publicly available security policy or incident response information, nor a vulnerability disclosure program, which could be areas for improvement. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong, with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low-risk profile with high business credibility and professionalism. The absence of WHOIS data for the exact www.hunton.com domain is noted but does not detract from the legitimacy of the firm given the comprehensive and consistent website content. Strategic recommendations include publishing explicit security policies, establishing a vulnerability disclosure channel, and enhancing transparency around data protection officer contacts and certifications.

55
88
17
85
72
80
100
lawfirmlegalservicesenergyfinancialservicesrealestate+4 more
Google Tag ManagerOneTrust Cookie ConsentWebP imagesSVG graphics
2025-07-07T07:52:10.627Z
alm.com favicon

ALM Global, LLC

alm.com

0
MediaUnited StateslargeMEDIUM

ALM Global, LLC operates a comprehensive media and intelligence platform focused primarily on the legal industry, delivering data, insights, marketing solutions, and events to a global audience of business leaders and practicing professionals. The company positions itself as a leading authority in the business of law, supported by a heritage of over 100 years and a strong digital presence. The website is professionally designed, content-rich, and optimized for user engagement, targeting legal professionals and related sectors. Technically, the website is built on WordPress with modern plugins and integrations including Yoast SEO, Tealium tag management, and Google Analytics. The site demonstrates good mobile optimization and SEO practices, though some accessibility features could be enhanced. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, but lacks explicit security headers and publicly available security policies or incident response information. Overall, the site reflects a mature digital infrastructure with moderate to good security and privacy compliance. The absence of WHOIS data due to privacy protection is typical for media companies and does not detract from the site's legitimacy. The business credibility is supported by consistent branding, social media presence, and clear market positioning. Recommendations include improving security headers, publishing security policies, and enhancing accessibility to further strengthen trust and compliance.

90
68
17
80
65
85
100
medialegalbusinessintelligenceevents+2 more
WordPress 6.7.1Google FontsjQueryYoast SEO plugin+4
2025-07-07T07:51:55.602Z
F

Federal Reserve History

federalreservehistory.org

0
GovernmentUnited StatesmediumMEDIUM

FederalReserveHistory.org is an authoritative educational website dedicated to providing comprehensive historical information about the Federal Reserve System. It offers essays, timelines, and biographies aimed at researchers, students, and the general public interested in the Federal Reserve's history and policy. The site positions itself as a trusted resource with consistent branding and professional content, serving a medium-sized audience primarily in the United States government and finance sectors. Technically, the website employs modern frameworks such as Bootstrap 5 and integrates Google Analytics and Tag Manager for tracking. The site is mobile-optimized and has good SEO practices, though accessibility could be improved. From a security perspective, the site enforces HTTPS and uses secure form inputs but lacks some security headers and explicit security policies or incident response information. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is partial, with a clear privacy policy but no cookie consent mechanism. WHOIS data is unavailable due to a malformed request, but the domain appears legitimate based on content and update timestamps. Overall, the website demonstrates a strong security posture with room for improvement in privacy and security transparency. The risk assessment indicates a low risk for users, with no adult or questionable content present. Strategic recommendations include implementing cookie consent, adding security headers, publishing security policies, and enhancing accessibility. These improvements would further strengthen trust and compliance while maintaining the site's authoritative position in Federal Reserve historical education.

90
53
2
70
70
85
100
federalreservehistoryfinancegovernmenteducation
Bootstrap 5Font AwesomeGoogle Tag ManagerGoogle Analytics
2025-07-07T07:51:20.424Z
federalreserveeducation.org favicon

Federal Reserve Education

federalreserveeducation.org

0
EducationUnited StateslargeMEDIUM

Federal Reserve Education operates a comprehensive, free educational platform focused on economics and personal finance resources tailored for K-12, college, and community educators. The website serves as an authoritative resource affiliated with the Federal Reserve, offering teaching materials, professional development opportunities, and events to support lifelong financial literacy. The platform is well-positioned in the education sector with a strong government affiliation, enhancing its credibility and trustworthiness. Technically, the website employs modern web technologies including Bootstrap, Google Fonts, and Google Tag Manager, ensuring a responsive and accessible user experience across devices. The site demonstrates good SEO practices and performance, although some improvements in security headers and cookie consent mechanisms could enhance compliance and user trust. From a security perspective, the site enforces HTTPS and uses secure forms with anti-forgery tokens, indicating a solid baseline security posture. However, the absence of explicit security headers and vulnerability disclosure information suggests room for improvement in transparency and defense-in-depth strategies. The lack of visible contact information and terms of service pages slightly detracts from the overall business credibility. Overall, the website presents a low-risk profile with high trustworthiness due to its official branding and educational mission. Strategic recommendations include implementing cookie consent banners, publishing security policies, enhancing security headers, and providing clear contact channels to further strengthen compliance and user confidence.

85
53
17
70
95
85
100
educationfinanceeconomicspersonalfinanceprofessionaldevelopment+1 more
Bootstrap 5.3.3Google FontsGoogle Tag ManagerSwiper.js+2
2025-07-07T07:51:15.416Z
fedcommunities.org favicon

Fed Communities

fedcommunities.org

0
GovernmentUnited StatesmediumMEDIUM

Fed Communities is a government-affiliated platform providing independent, nonpartisan information and insights from the Federal Reserve's community development teams. The website serves community leaders, policymakers, researchers, and nonprofit organizations by offering research, data tools, events, and stories focused on economic development and workforce resilience. The site is positioned as an authoritative resource within the Federal Reserve System, with consistent branding and a clear mission to support strong, resilient communities. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, HubSpot analytics and forms, Google Tag Manager, and Crazy Egg for tracking. The site is hosted via GoDaddy and uses HTTPS with a good SSL configuration, though DNSSEC is not enabled. Performance is moderate with good mobile optimization and basic accessibility features. SEO is well supported through structured data and meta tags. From a security perspective, the site uses HTTPS and has domain status protections but lacks visible security headers and published security policies or incident response information. No vulnerability disclosure or security.txt file is present. Privacy compliance is weak as no privacy or cookie policies are found, and no consent mechanisms are detected. Contact information is limited to a contact form and social media links, with no direct emails or phone numbers published. Overall, the website is a credible and professional resource with strong content quality and business credibility. However, it would benefit from improved privacy compliance, enhanced security headers, and published security policies to strengthen trust and compliance posture.

30
68
25
70
-
85
100
federalreservecommunitydevelopmenteconomicresearchdatatoolsevents+2 more
WordPress 6.7.2Yoast SEO Premium pluginHubSpot analytics and formsGoogle Tag Manager+5
2025-07-07T07:51:10.405Z
frbservices.org favicon

Federal Reserve Banks

frbservices.org

0
FinanceUnited StatesenterpriseMEDIUM

The Federal Reserve Financial Services website represents the official online presence of the Federal Reserve Banks' financial services division. It provides comprehensive information and access to a wide range of financial services targeted primarily at depository institutions and banks. The site highlights key services such as electronic fund transfers, check collection, cash and coin distribution, and newer offerings like the FedNow Service. The Federal Reserve Banks hold a dominant market position as the central banking authority in the United States, and this website serves as a critical resource for their institutional customers. Technically, the website employs a modern technology stack including Bootstrap for responsive design, jQuery, and integrates multiple analytics tools such as Google Analytics and LinkedIn Insight Tag. The site is mobile-optimized and accessible, with good SEO practices evident in meta tags and structured navigation. Hosting and DNS services are provided by reputable providers, and the domain is well-established with a creation date in 1998. From a security perspective, the site enforces HTTPS and uses domain status flags to prevent unauthorized changes. However, it lacks DNSSEC and certain security headers that could enhance protection. There is no publicly available security policy or incident response information, nor a vulnerability disclosure program. Privacy compliance is basic, with a clear privacy policy but no cookie consent mechanism detected. The use of privacy protection in WHOIS is justified given the nature of the organization. Overall, the website is professional, trustworthy, and well-maintained, with a strong business credibility score. Recommendations include enabling DNSSEC, adding security headers, publishing security policies, and implementing a vulnerability disclosure mechanism to further strengthen security posture and compliance.

80
53
10
70
100
85
100
federalreservefinancialservicesbankingfedwirefedach+4 more
Google AnalyticsGoogle Tag ManagerjQueryBootstrap+2
2025-07-07T07:51:05.396Z
dallasfed.org favicon

Federal Reserve Bank of Dallas

dallasfed.org

0
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of Dallas website serves as the official digital presence of one of the twelve regional Reserve Banks in the United States. It provides authoritative economic research, data, community development initiatives, banking supervision resources, and educational materials targeted at economists, policymakers, bankers, and the public within the Eleventh Federal Reserve District. The site is well-branded, professionally designed, and offers comprehensive content that supports its role as a government entity within the Federal Reserve System. Technically, the website employs modern web technologies including Bootstrap for responsive design, Google Analytics and Tag Manager for user tracking, and embeds multimedia content via Vimeo. The site is mobile-optimized and accessible, with clear navigation and SEO best practices. However, some security best practices such as explicit security headers and cookie consent mechanisms could be improved. From a security perspective, the site uses HTTPS exclusively and does not expose sensitive data in its HTML content. The absence of WHOIS data due to a malformed WHOIS response limits domain registration insights, but the strong official branding and consistent content quality support its legitimacy. No WAF or blocking mechanisms were detected, allowing full content access. Overall, the website demonstrates a strong security posture and high business credibility, with minor areas for improvement in privacy compliance and security header implementation. The risk level is low, and the site is trustworthy for its intended audience.

65
53
2
70
95
85
100
federalreserveeconomybankingtexasenergy+3 more
Google AnalyticsGoogle Tag ManagerBootstrap (CSS/JS)jQuery+1
2025-07-07T07:51:00.378Z
communitybankingconnections.org favicon

Federal Reserve System

communitybankingconnections.org

0
FinanceUnited StatesenterpriseMEDIUM

Community Banking Connections is an official publication of the Federal Reserve System, providing supervision and regulation resources targeted at community banks. The website serves as a centralized hub for industry news, policy guidance, and outreach initiatives, positioning itself as a trusted government resource in the finance sector. The content is well-organized and professionally presented, reflecting the authoritative nature of the Federal Reserve System. Technically, the website employs a mature technology stack including ASP.NET Web Forms, jQuery, and Google Tag Manager for analytics. The site is mobile responsive and features interactive elements such as sliders and tabs, though some modern security headers and cookie consent mechanisms are absent. Performance is moderate with room for optimization, and SEO practices are basic but adequate for the target audience. From a security perspective, the site uses HTTPS and avoids exposing sensitive data. However, the lack of explicit security headers and absence of a vulnerability disclosure policy indicate areas for improvement. The WHOIS data is unavailable, likely due to registry privacy policies, but the domain's alignment with Federal Reserve branding and content supports its legitimacy. Overall, the site maintains a good security posture but could enhance compliance and transparency. The overall risk assessment is low given the governmental nature of the site and its professional presentation. Strategic recommendations include implementing comprehensive security headers, adding cookie consent for privacy compliance, publishing security and incident response policies, and maintaining up-to-date third-party libraries to mitigate vulnerabilities.

45
53
17
70
85
85
100
communitybankingfederalreservebankingregulationsupervisionfinance+1 more
jQuery 3.6.0jQuery UI 1.8.16Nivo SliderGoogle Tag Manager+2
2025-07-07T07:50:50.357Z
F

Federal Reserve Bank of Kansas City

kansascityfed.org

0
FinanceUnited StateslargeHIGH

The Federal Reserve Bank of Kansas City website serves as an official portal for the Tenth Federal Reserve District, providing central banking services, economic research, and community development support. The site targets financial institutions, economists, policymakers, and community organizations. It is part of the larger Federal Reserve System, positioning it as a key regional financial institution within the United States. Technically, the website utilizes the Sitecore CMS platform and integrates common analytics and tracking tools such as Google Analytics, Google Tag Manager, and Crazy Egg. The performance and mobile optimization are moderate to basic, with room for improvement in accessibility and SEO. The site lacks visible privacy and cookie policies, which impacts privacy compliance scoring. From a security perspective, the site uses HTTPS but lacks visible security headers and explicit security policies or incident response contacts. The WHOIS data is unavailable due to a malformed response, but the domain appears legitimate given its .org TLD and consistent branding. No vulnerabilities or suspicious patterns were detected in the provided content. Overall, the website is professional and trustworthy but would benefit from enhanced privacy disclosures, security headers, and clearer contact information to improve compliance and security posture.

-
35
2
70
-
85
100
financegovernmentfederalreserveeconomicresearchbanking
Google AnalyticsGoogle Tag ManagerCrazy Egg
2025-07-07T07:50:45.347Z
federalreserveconsumerhelp.gov favicon

Federal Reserve Consumer Help

federalreserveconsumerhelp.gov

0
GovernmentUnited StateslargeMEDIUM

Federal Reserve Consumer Help is an official U.S. government website providing consumer assistance related to banking and financial institutions. It offers complaint filing services, educational resources, and consumer alerts to help individuals resolve issues with banks and other financial entities. The site serves as a trusted portal linking consumers to appropriate regulatory agencies and providing guidance on financial topics. The website is positioned as a key government resource in the financial consumer protection space. Technically, the website employs a modern but straightforward technology stack including jQuery and Google Analytics via Google Tag Manager. The site is well-structured, mobile-optimized, and accessible, with good SEO practices. However, some security headers appear to be missing, and no cookie consent mechanism was detected, which may be due to government exemptions. The site uses HTTPS exclusively, ensuring secure communications. From a security perspective, the site demonstrates a strong posture with no visible vulnerabilities or exposed sensitive data. The lack of explicit security or incident response policies is a minor gap. WHOIS data is unavailable due to privacy or registry restrictions typical for .gov domains, but the domain and content strongly indicate legitimacy. Overall, the site is secure, trustworthy, and professionally maintained. The overall risk is low given the official nature of the site and its security posture. Strategic recommendations include adding security headers, publishing incident response information, and implementing a cookie consent mechanism to enhance privacy compliance and user trust.

45
53
2
70
-
85
100
governmentfinanceconsumer-helpbankingcomplaints+1 more
jQuery 3.5.2Google Tag ManagerGoogle Analytics (gtag.js)
2025-07-07T07:50:40.265Z
49ers.com favicon

San Francisco 49ers

49ers.com

0
MediaUnited StateslargeMEDIUM

The San Francisco 49ers official website serves as a comprehensive digital platform for fans and stakeholders, providing news, multimedia content, ticketing, and merchandise services. The site is well-branded, professionally designed, and targets NFL fans and sports enthusiasts primarily in the United States. The business model focuses on fan engagement, media distribution, and e-commerce related to the team. Technically, the site employs a modern tech stack including Google Publisher Tags, OneSignal for push notifications, Adobe DTM for tag management, and Gigya for identity management, indicating a mature digital infrastructure. Performance and mobile optimization are good, with strong SEO and accessibility features implemented. Security posture is robust with HTTPS enforced and multiple security headers present, though there is room for improvement in publishing explicit security policies and incident response contacts. Privacy compliance is well addressed with comprehensive privacy and cookie policies and consent mechanisms. The absence of WHOIS data is a notable gap but likely due to registry policies rather than malicious intent. Overall, the site is trustworthy, professional, and secure, serving its audience effectively.

50
100
17
70
62
80
100
sportsnflfootballsanfrancisco49ersmedia+3 more
JavaScriptGoogle Publisher Tags (GPT)OneSignal Push NotificationsAdobe DTM (Dynamic Tag Manager)+5

Partner Domains:

go.rakuten.com
partner
levisstadium.com
partner

+1 more partners

2025-07-07T06:45:52.648Z
powersystemstoday.com favicon

PowerSystemsToday

powersystemstoday.com

0
EnergyUnited StatesmediumMEDIUM

PowerSystemsToday.com is a specialized online marketplace focused on new and used power systems and generators, serving a niche market within the energy sector. It offers a comprehensive platform for buyers and sellers, including dealer portals and VIP services, and is part of the larger Sandhills Global family, which lends credibility and operational support. The website is well-structured with clear navigation, modern design, and up-to-date content, targeting both individual and business customers seeking power solutions. Technically, the site leverages modern web technologies such as React and Material-UI, integrates Google Analytics and Tag Manager for tracking, and employs HTTPS with strong security headers, indicating a mature digital infrastructure. Mobile optimization and accessibility are well addressed, enhancing user experience across devices. From a security perspective, the site demonstrates good practices including secure forms with anti-CSRF tokens and cookie consent mechanisms aligned with GDPR. However, it lacks publicly available security policies and incident response contacts, which are recommended for enhanced transparency and trust. The absence of WHOIS data is a notable anomaly but does not detract significantly from the overall legitimacy given the strong brand association. Overall, PowerSystemsToday.com presents a low-risk profile with a solid business foundation and technical implementation. Strategic improvements in security transparency and WHOIS data availability would further strengthen trust and compliance.

30
100
17
95
57
85
100
powersystemsgeneratorsenergymarketplaceindustrialequipment+1 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

www.sandhills.com
parent
vip.powersystemstoday.com
subsidiary

+1 more partners

2025-07-07T06:45:32.512Z
motorsportsuniverse.com favicon

MotorSportsUniverse

motorsportsuniverse.com

0
TransportationUnited StatesmediumMEDIUM

MotorSportsUniverse.com operates as a specialized online marketplace dedicated to the buying and selling of new and used powersports and motorsports vehicles. The platform caters to enthusiasts and dealers by providing a comprehensive database of vehicles including ATVs, UTVs, motorcycles, dirt bikes, and snowmobiles. It is part of the Sandhills Global family, a well-established company with a broad portfolio of industry-specific marketplaces, enhancing its market credibility and reach. Technically, the website leverages modern web technologies such as React and Material-UI, ensuring a responsive and user-friendly experience across devices. The site integrates Google Analytics and Tag Manager for data-driven insights and marketing optimization. SEO and accessibility practices are well implemented, contributing to good performance and discoverability. From a security perspective, the site enforces HTTPS and includes standard security headers, CSRF protections, and cookie consent mechanisms, reflecting a mature security posture. However, the absence of a publicly available security policy and incident response information indicates areas for improvement. The WHOIS data is notably missing or unavailable, which raises some concerns about domain registration transparency but is partially mitigated by the professional presentation and association with Sandhills Global. Overall, MotorSportsUniverse.com presents a solid, trustworthy platform with good technical and security foundations. Strategic enhancements in transparency around security policies and domain registration details would further strengthen trust and compliance.

20
100
17
95
57
85
100
motorsportspowersportsvehiclesmarketplaceatvs+5 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

sandhills.com
parent
tractorhouse.com
sister

+3 more partners

2025-07-07T06:45:12.438Z
utilitytrailerstoday.com favicon

UtilityTrailersToday

utilitytrailerstoday.com

0
TransportationUnited StatesmediumMEDIUM

UtilityTrailersToday.com is a specialized online marketplace focused on the buying and selling of new and used utility trailers. It offers a broad range of trailer types including cargo, dump, flatbed, car haulers, and more, catering to buyers and sellers in the transportation and equipment sectors. The platform is operated by Sandhills Global, a reputable company with a strong presence in equipment marketplaces, which lends credibility and market positioning to the site. The website provides detailed listings, search capabilities, dealer portals, and financing options, positioning itself as a comprehensive resource in its niche. From a technical perspective, the website employs modern web technologies such as React and Material UI, ensuring a responsive and user-friendly experience. It integrates Google Tag Manager and Google Analytics for tracking and marketing purposes. The site is well-structured with good SEO and accessibility practices, though some improvements could be made in privacy and security policy disclosures. Security-wise, the site uses HTTPS and has some security best practices in place, but lacks explicit security headers like Content-Security-Policy and X-Frame-Options. There is no visible privacy or cookie policy, which is a compliance gap. The WHOIS data is unavailable, which is unusual but the backing by Sandhills Global mitigates trust concerns. Overall, the security posture is moderate with room for improvement. The overall risk assessment is moderate; the site is professionally operated and technically sound but should enhance transparency around privacy, cookie usage, and security policies. Strategic recommendations include adding comprehensive privacy and cookie policies, implementing security headers, and publishing a vulnerability disclosure or security.txt file to improve trust and compliance.

20
100
17
80
57
80
100
utilitytrailersequipmentmarketplacetransportationonlinesalessandhillsglobal
ReactMaterial UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

www.sandhills.com
parent
vip.utilitytrailerstoday.com
subsidiary
2025-07-07T06:45:07.429Z
rentalyard.com favicon

RentalYard

rentalyard.com

0
TransportationUnited StatesmediumMEDIUM

RentalYard.com operates as a specialized online marketplace and marketing platform focused on the rental and leasing of heavy equipment, farm machinery, trucks, trailers, and attachments. The platform targets contractors, fleet operators, equipment dealers, and rental companies, providing a robust inventory and tools to facilitate equipment rental transactions. It is positioned as a niche player within the transportation sector, supported by its parent company Sandhills Global, which lends credibility and operational support. Technically, the website leverages modern web technologies including React and Material-UI, with integrations for Google Analytics and Tag Manager for marketing and analytics purposes. The site is well-structured, mobile-optimized, and employs standard SEO and accessibility practices, though accessibility could be further enhanced. Performance is moderate, with a professional design and clear navigation. From a security perspective, the site enforces HTTPS with strong SSL configurations and includes security headers such as Content Security Policy and Strict-Transport-Security. Forms use CSRF tokens, and no sensitive data is exposed in the HTML. However, explicit security policies and incident response information are not published, and no vulnerability disclosure or security.txt files are present, which are areas for improvement. The domain WHOIS data is notably absent, which raises concerns about domain registration transparency and trustworthiness. Despite this, the website content and business association with Sandhills Global suggest legitimacy. Privacy and cookie policies are present with consent mechanisms, indicating compliance with GDPR and related regulations. Overall, RentalYard.com is a professionally managed and secure platform with a clear business focus and good technical implementation. Addressing the WHOIS transparency and publishing detailed security policies would further strengthen trust and compliance.

20
100
17
95
57
85
100
equipmentrentalconstructionequipmentfarmequipmenttruckrentaltrailers+3 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

sandhills.com
parent
sandhillscloud.com
partner

+1 more partners

2025-07-07T06:44:57.409Z
gocurrency.com favicon

Currency®

gocurrency.com

0
FinanceUnited StatesmediumMEDIUM

Currency® is a fintech company specializing in providing fast and secure financing solutions for heavy equipment, trucks, trailers, aircraft, and business working capital in the U.S. and Canada. Operating under the parent company Sandhills Global, Currency leverages a network of over 30 trusted lenders to facilitate loans and leases, serving over 200,000 businesses with significant funding volumes. The website presents a professional and comprehensive platform with clear navigation, rich content, and multiple financing product offerings tailored to various industries such as agriculture, construction, and transportation. Technically, the website is built on WordPress and utilizes modern web technologies including jQuery, Google Tag Manager, and Slick Slider for interactive content. The site is mobile-optimized, accessible, and SEO-friendly, with structured data enhancing search engine visibility. Security posture is strong with HTTPS enforced, appropriate security headers, and no visible vulnerabilities. Privacy compliance is addressed with clear privacy and cookie policies, including consent mechanisms and GDPR considerations. However, the WHOIS data for the domain www.gocurrency.com is missing or indicates the domain is not registered, which is inconsistent with the active and professional website presence. This discrepancy suggests the need for further verification of domain registration status. Overall, the site demonstrates a mature digital presence with robust business credibility but requires attention to domain registration transparency. Strategic recommendations include publishing a dedicated security policy, establishing vulnerability disclosure and incident response contacts, and continuous auditing of third-party scripts to maintain security integrity.

50
68
17
95
47
85
100
financeequipmentfinancingaircraftfinancingbusinessloansfintech+1 more
jQueryGoogle Tag ManagerYouTube Player APISlick Slider+2

Partner Domains:

sandhills.com
parent
2025-07-07T06:44:47.391Z
futurehousingleaders.com favicon

Fannie Mae

futurehousingleaders.com

0
FinanceUnited StatesenterpriseMEDIUM

Fannie Mae is a prominent government-sponsored enterprise that plays a critical role in the U.S. housing finance system by providing liquidity to mortgage lenders and supporting affordable housing initiatives. The website reflects a mature digital presence with a focus on serving homebuyers, homeowners, mortgage lenders, and investors. It offers comprehensive information about its services and maintains a professional and consistent brand image. The technical infrastructure is built on Drupal 11, leveraging modern marketing and analytics tools such as Google Tag Manager, Crazy Egg, and Visual Website Optimizer to optimize user experience and engagement. The site is mobile-optimized and accessible, with good SEO practices in place. From a security perspective, the website enforces HTTPS, employs multiple security headers, and follows best practices for secure forms and data handling. The presence of ISO 27001 certification and adherence to NIST frameworks indicate a strong commitment to information security. Privacy policies and cookie consent mechanisms are comprehensive and GDPR compliant, reflecting a mature privacy posture. Incident response contacts and vulnerability disclosure policies are clearly stated, enhancing trustworthiness. Overall, the website demonstrates a high level of professionalism, security, and compliance suitable for a major financial institution. The only notable concern is the absence of publicly available WHOIS data, which is unusual for such an entity but may be due to registry policies or privacy protection. This does not detract significantly from the overall trustworthiness given the strong business and security indicators present.

50
73
17
100
90
90
100
financemortgagehousingdrupalanalytics+1 more
Drupal 11Google Tag ManagerCrazy EggVisual Website Optimizer (VWO)

Partner Domains:

futurehousingleaders.com
partner
knowyouroptions.com
partner

+2 more partners

2025-07-07T06:44:17.329Z
S

State of Indiana

in.gov

0
GovernmentUnited StatesenterpriseMEDIUM

IN.gov is the official website of the State of Indiana, serving as a comprehensive portal for residents, visitors, businesses, and government employees. It provides access to a wide range of state services including job applications, health programs, licensing, and government resources. The site is positioned as an authoritative source for Indiana state government information and services, targeting a broad audience including citizens and businesses within the state. Technically, the website employs standard modern web technologies such as HTML5, CSS3, Google Fonts, and FontAwesome icons. It includes accessibility features and a Google Translate widget to support language translation, indicating a commitment to usability and inclusivity. The site appears moderately optimized for performance and mobile devices, with good SEO practices evident from meta tags and Open Graph data. From a security perspective, the site uses HTTPS as implied by URLs, but lacks explicit security headers and visible security policies or incident response information. The WHOIS data is incomplete, lacking registrar and nameserver details, which is unusual but likely due to registry restrictions on government domains. No vulnerabilities or tracking scripts were detected in the provided content, suggesting a low risk profile. However, the absence of privacy and cookie policies and contact information for security or general inquiries represents an area for improvement. Overall, IN.gov demonstrates a solid business credibility and trustworthy presence as a government portal. The main risks relate to transparency in WHOIS data and privacy compliance documentation. Strategic recommendations include publishing clear privacy and cookie policies, adding security headers, and providing incident response contacts to enhance trust and security posture.

30
35
17
70
77
70
100
governmentstateindianaofficialpublicservices+3 more
HTML5CSS3Google FontsFontAwesome icons+1
2025-07-07T06:44:12.322Z
nglccny.org favicon

National LGBT Chamber of Commerce New York

nglccny.org

0
OtherUnited StatesmediumMEDIUM

The National LGBT Chamber of Commerce New York (nglccNY) serves as the New York Metro headquarters for the National LGBT Chamber of Commerce, a leading non-profit advocacy organization dedicated to expanding economic opportunities for the LGBT community. The organization focuses on certifying LGBT-owned businesses and advocating for their advancement in the marketplace. The website reflects a professional and consistent brand presence, targeting LGBT business owners and allies with services centered on certification and advocacy. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and integrates SEO tools like Yoast SEO. It uses Google Analytics and Tag Manager for tracking and marketing forms for engagement. The site is hosted on Azure CDN, indicating a reliable hosting infrastructure. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS as indicated by canonical URLs, but lacks visible security headers in the provided data. No exposed sensitive data or vulnerabilities were detected. Privacy and cookie policies are not explicitly found, which is a compliance gap. WHOIS data is privacy protected or unavailable, which is typical for non-profits but limits domain trust verification. Overall, the website presents a trustworthy and professional front for a non-profit advocacy organization with moderate technical maturity and some room for improvement in privacy compliance and security hardening. Strategic recommendations include implementing explicit privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

30
35
10
70
62
65
100
lgbtbusinessnon-profitcertificationadvocacy+2 more
WordPressYoast SEOGoogle AnalyticsFontAwesome+2
2025-07-07T06:44:07.316Z
naag.org favicon

National Association of Attorneys General

naag.org

0
GovernmentUnited StatesmediumMEDIUM

The National Association of Attorneys General (NAAG) operates as a nonpartisan national forum dedicated to empowering and supporting attorneys general across the United States. The organization provides training, research, policy advocacy, and resources through various centers and initiatives, positioning itself as a key resource and collaborative platform for legal professionals in government. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to its target audience. Technically, the site is built on WordPress with modern plugins and integrations such as Gravity Forms, Google Tag Manager, and Hotjar, indicating a well-maintained infrastructure. The site is mobile-optimized and accessible, with good SEO practices and structured data enhancing search visibility. Security measures include HTTPS enforcement and multiple security headers, contributing to a strong security posture. However, the absence of explicit privacy and cookie policies and the lack of WHOIS registration data introduce some concerns regarding transparency and compliance. While the site uses tracking and analytics tools, it lacks visible GDPR compliance mechanisms such as cookie consent banners. Overall, the security posture is solid but could be improved with clearer privacy disclosures and incident response information. The risk assessment suggests a generally trustworthy and professional site with moderate risk due to missing WHOIS data and privacy policy gaps. Strategic recommendations include publishing comprehensive privacy and cookie policies, implementing consent mechanisms, and enhancing transparency around security and data protection practices.

30
73
47
65
52
75
100
governmentlegalattorneysgeneralnonprofittraining+3 more
WordPressGravity FormsGoogle Tag ManagerHotjar+5
2025-07-07T06:43:57.298Z
F

Federal Reserve Bank of St. Louis

stlouisfed.org

0
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of St. Louis operates as one of the 12 regional Reserve Banks within the Federal Reserve System, serving a critical role in the U.S. central banking framework. The website provides extensive economic resources, data tools, research publications, and educational materials targeted at economists, financial institutions, educators, and the general public. It maintains a strong market position as an authoritative source for economic data and Federal Reserve information. Technically, the website employs a modern technology stack including Bootstrap 4, jQuery, Google Tag Manager, and analytics tools such as Google Analytics and Crazy Egg. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes several security best practices. While some security headers are not explicitly detected, the overall posture is strong with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance. Overall, the website is highly professional, trustworthy, and aligned with the Federal Reserve's mission. The lack of WHOIS data is mitigated by the authoritative content and branding. The site poses low risk and serves as a reliable resource for its audience.

-
58
25
70
-
85
100
federalreserveeconomicdatabankingresearcheducation+1 more
jQuery 3.7.1Bootstrap 4Google Tag ManagerGoogle Analytics+3

Partner Domains:

fred.stlouisfed.org
partner
fraser.stlouisfed.org
partner

+2 more partners

2025-07-07T05:34:17.366Z
C

Cities for Financial Empowerment Fund

cfefund.org

0
GovernmentUnited StatesmediumMEDIUM

Cities for Financial Empowerment Fund (CFE Fund) is a US-based non-profit organization founded in 2011 that supports mayors and local governments across the country by providing grant funding and strategic assistance to embed financial empowerment initiatives in municipal operations. The organization has a strong market position with partnerships in approximately 145 cities, directly supporting over 900,000 residents. Their key services include grant distribution, program development, and impact reporting focused on improving financial stability for city residents. Technically, the website is built on WordPress with a modern tech stack including Gravity Forms for data collection, Google Analytics for tracking, and Cloudflare for DNS management. The site demonstrates good mobile optimization, accessibility, and SEO practices, though performance is moderate. The infrastructure is typical for a mid-sized non-profit organization. From a security perspective, the site uses HTTPS and CAPTCHA on forms, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No exposed sensitive data or vulnerabilities were detected in the HTML content. Privacy compliance is basic, with a privacy policy and terms of service present but no cookie consent mechanism. Contact information is available, but no dedicated security policy or incident response contacts were found. Overall, the website is professional, trustworthy, and safe for general audiences. The security posture is adequate but could be improved with additional DNS and header configurations. The organization’s domain registration is privacy protected, consistent with non-profit practices, and the domain age aligns with the organization's history.

30
53
17
60
75
65
100
non-profitfinancialempowermentgovernmentcitiesgrants+1 more
WordPressGravity FormsGoogle AnalyticsCloudflare DNS+6
2025-07-07T05:34:12.358Z
paperstreet.com favicon

PaperStreet Web Design, Inc.

paperstreet.com

0
TechnologyUnited StatesmediumMEDIUM

PaperStreet Web Design, Inc. is a specialized digital marketing agency focused on law firm website design, SEO, PPC, content writing, branding, and internet marketing services. Established in 2001 and founded by a lawyer, the company has built a strong reputation with over 2,500 law firm clients worldwide. Their market position is reinforced by numerous industry awards and certifications, including Google Premier Partner status. The company targets law firms of all sizes and businesses seeking professional web design and marketing solutions. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, Swiper.js, and CallRail for analytics and call tracking. The site demonstrates excellent performance, mobile optimization, accessibility, and SEO best practices. The use of HTTPS and implied security headers indicates a strong security posture, although explicit security headers could be improved. Security-wise, the site shows good practices with no visible vulnerabilities or exposed sensitive data. However, there is no visible cookie consent mechanism, and no dedicated security or incident response pages were found. The WHOIS data is unavailable or privacy protected, which is common but reduces transparency. Overall, the site is professional, trustworthy, and secure with minor areas for improvement. The overall risk assessment is low, with recommendations to enhance privacy compliance by adding cookie consent, publishing security policies, and improving WHOIS transparency. The company’s strong business credibility and technical maturity position it well in the competitive law firm marketing space.

55
35
2
85
75
80
100
lawfirmwebdesigninternetmarketingseoppc+3 more
WordPressYoast SEO PremiumSwiper.jsCallRail+1

Partner Domains:

lawfirmessentials.com
partner
2025-07-07T05:33:42.305Z
L

Lewis Baach Kaufmann Middlemiss PLLC

lewisbaach.com

0
FinanceUnited StatessmallMEDIUM

Lewis Baach Kaufmann Middlemiss PLLC is a boutique international law firm specializing in complex litigation, financial crimes compliance, and international disputes with offices in Washington DC, New York, and London. The firm targets corporate clients, financial institutions, and professionals requiring expert legal services in areas such as bank fraud, asset tracing, and white collar criminal defense. Their market position is that of a specialized boutique firm with a strong reputation in financial and compliance legal matters. Technically, the website employs modern analytics and marketing tools including Google Analytics, Localize.js for language support, and Constant Contact for client engagement. The site is served over HTTPS with reCAPTCHA protecting forms, indicating a baseline security posture. However, the absence of security headers and cookie consent mechanisms suggests room for improvement in security and privacy compliance. Security-wise, the website shows no signs of vulnerabilities or exposed sensitive data. The lack of WHOIS data is a concern for domain legitimacy but does not detract significantly from the professional presentation and trust signals on the site. Overall, the site is secure but could enhance compliance and transparency. The overall risk is moderate with recommendations to improve security headers, implement cookie consent, publish incident response policies, and clarify domain registration details to strengthen trust and compliance.

40
53
17
80
62
80
100
lawlegallitigationcomplianceinternational+2 more
Google Analytics (gtag.js)Localize.jsConstant Contact signup formsGoogle reCAPTCHA
2025-07-07T05:33:32.286Z
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

0
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
hirschlerlaw.com favicon

Hirschler Fleischer

hirschlerlaw.com

0
Real EstateUnited StatesmediumMEDIUM

Hirschler Fleischer is a professional law firm based in Virginia, providing a broad range of legal services with a focus on client success and complex legal issues. The firm positions itself as a national-caliber entity with a strong emphasis on partner involvement and business efficiency. Their website reflects a medium-sized firm with consistent branding and professional content aimed at business and individual clients seeking legal counsel. Technically, the website employs modern web standards including HTTPS, Google Tag Manager for analytics, and responsive design elements. While the site performs moderately well and offers good accessibility and SEO features, there is room for improvement in security headers and cookie consent mechanisms to enhance privacy compliance. From a security perspective, the site benefits from HTTPS and secure form practices but lacks visible security headers and a formal vulnerability disclosure policy. The absence of WHOIS data raises questions about domain registration legitimacy, although the professional presentation and external references support the firm's credibility. Overall, the site is safe, trustworthy, and suitable for general audiences. Strategically, the firm should address privacy compliance gaps, enhance security headers, and clarify domain registration details to strengthen trust and security posture.

40
53
17
70
72
80
100
lawfirmlegalservicesvirginiaprofessionalservicesbusinesslaw+1 more
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:33:17.250Z
wiley.law favicon

Wiley Rein LLP

wiley.law

0
GovernmentUnited StateslargeMEDIUM

Wiley Rein LLP is a prominent law firm based in Washington, DC, specializing in a broad range of legal fields including Election Law, Environment, Government Contracts, Insurance, Intellectual Property, International Trade, Litigation, Telecom, and White Collar Defense. The firm boasts a large team of 260 attorneys and maintains a strong market position as a leading legal service provider with deep government connections. Their business model focuses on delivering specialized legal and regulatory advice to corporate and government clients. The website reflects a professional and authoritative presence consistent with their market stature. Technically, the website employs modern analytics and tracking technologies such as Google Analytics, Google Tag Manager, Hotjar, and Siteimprove Analytics, combined with a responsive design and good accessibility features. The site is well-structured with clear navigation and optimized for SEO, providing a positive user experience. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms aligned with GDPR compliance. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data is unavailable, likely due to privacy protection, which is justified for a law firm. Overall, the security posture is solid but could be enhanced with additional headers and transparency. The overall risk assessment is low, with the website demonstrating high professionalism, trustworthiness, and compliance. Strategic recommendations include implementing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen security and trust.

70
68
17
80
52
80
100
lawfirmlegalserviceswashingtondcgovernmentcontractsintellectualproperty+4 more
Google Tag ManagerGoogle AnalyticsHotjarSiteimprove Analytics+1
2025-07-07T05:33:07.224Z
L

Law.com, Inc.

law.com

0
MediaUnited StateslargeMEDIUM

Law.com, Inc. operates as a premier global legal news and information provider, delivering trusted and timely legal news, analysis, and data to legal professionals. Positioned as a leading media entity in the legal sector, it offers a subscription-based business model targeting legal professionals and organizations. The company is a subsidiary of ALM, a well-established media group, and has been in operation since 1998. The website reflects a professional and authoritative brand with excellent content quality and strong trust indicators such as industry awards and verified contact information. Technically, the website leverages modern web technologies including Nuxt.js and Vue.js frameworks, supported by AWS Cloudfront CDN for performance optimization. The site is mobile-optimized, accessible, and SEO-friendly, with a fast loading experience. Integration with marketing and analytics tools such as Omeda and Tealium indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and employs best practices such as asynchronous script loading and no visible vulnerable libraries. However, explicit security headers and a cookie consent mechanism are not clearly detected, suggesting areas for improvement. The absence of WHOIS data is noted but likely due to privacy or registry restrictions, not detracting significantly from the site's legitimacy given its strong brand presence. Overall, Law.com presents a low-risk profile with a strong business and technical foundation. Strategic recommendations include enhancing privacy compliance with visible cookie consent, improving security headers, and publishing a vulnerability disclosure policy to further strengthen trust and security posture.

15
58
47
70
75
80
100
legalnewsmedialawlegalresources+2 more
JavaScriptTailwindCSSVue.js (implied by Nuxt.js usage)Nuxt.js+3

Partner Domains:

alm.com
parent
verdictsearch.com
partner

+1 more partners

2025-07-07T05:33:02.215Z
sheppardmullin.com favicon

Sheppard Mullin

sheppardmullin.com

0
OtherUnited StateslargeMEDIUM

Sheppard Mullin is a prominent AmLaw 100 law firm with a broad international presence across the United States, Europe, and Asia. The firm offers a comprehensive range of legal services spanning numerous practice areas including corporate law, litigation, intellectual property, privacy and cybersecurity, and more. Their website reflects a mature digital presence with professional branding, clear navigation, and extensive content tailored to corporate clients and legal professionals. The firm positions itself as a leader in the legal industry with recognized awards and a strong market reputation. From a technical perspective, the website employs modern web technologies including Google Tag Manager, Adobe DTM, and various analytics and marketing pixels. The site is mobile-optimized and includes accessibility features such as the UserWay widget, indicating a commitment to compliance and user inclusivity. Performance is moderate with good SEO and accessibility standards met. Security-wise, the site enforces HTTPS and uses several best practices, though it lacks explicit security headers and a public security policy or vulnerability disclosure page. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low risk profile with a high degree of professionalism and trustworthiness. The absence of WHOIS data is a notable anomaly but does not detract significantly from the site's legitimacy given the comprehensive and consistent business information presented. Strategic recommendations include enhancing security headers, publishing a security policy, and adding a vulnerability disclosure mechanism to further strengthen trust and security posture.

70
68
47
70
67
85
100
lawfirmlegalservicesamlaw100privacypolicycookiepolicy+2 more
JavaScriptGoogle Tag ManagerSiteimprove AnalyticsLinkedIn Insight Tag+3
2025-07-07T05:32:42.180Z
schwabe.com favicon

Schwabe

schwabe.com

0
OtherUnited StateslargeMEDIUM

Schwabe is a well-established regional law firm with over 130 years of history, focusing on providing tailored legal services across various industries in the Northwest United States. Their website reflects a professional and comprehensive presentation of their services, emphasizing industry-specific expertise and client commitment. The firm targets businesses and legal professionals seeking specialized counsel in sectors such as manufacturing, healthcare, natural resources, maritime, real estate, and technology. The business model centers on delivering legal solutions aligned with regional and industry needs, positioning Schwabe as a trusted legal partner in their market. Technically, the website is built on WordPress and incorporates modern web technologies including Google Fonts, Google Tag Manager, and New Relic for performance monitoring. The site is mobile-optimized, accessible, and SEO-friendly, with a fast to moderate performance profile. Security measures include HTTPS enforcement, use of Google reCAPTCHA on forms, and a cookie consent mechanism, indicating a mature digital infrastructure. From a security perspective, the site demonstrates good practices such as encrypted connections and bot protection. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. The absence of WHOIS data reduces transparency but does not detract significantly from the site's legitimacy given the professional presentation and consistent branding. Overall, Schwabe's website presents a low-risk profile with strong business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing security policies, and improving WHOIS transparency to further strengthen trust and compliance.

25
53
2
70
95
80
100
lawfirmlegalservicesprofessionalservicesregionalbusinessindustryfocused
WordPressGoogle FontsGoogle Tag ManagerGoogle reCAPTCHA+2
2025-07-07T05:32:32.166Z
M

Mitchell Silberberg & Knupp LLP

msk.com

0
MediaUnited StateslargeMEDIUM

Mitchell Silberberg & Knupp LLP is a well-established full-service law firm with deep roots in the Los Angeles entertainment industry since 1908. The firm has expanded nationally with offices in Los Angeles, New York, and Washington, D.C., offering a broad range of legal services including intellectual property, litigation, labor and employment, corporate law, immigration, regulatory, tax, and trusts & estates. The website reflects a professional and stable firm culture with a focus on creative legal advisory and business partnership. Technically, the website employs modern web technologies such as HTML5 video, JWPlayer, and integrates Google Analytics and Tag Manager for tracking. The site is moderately optimized for performance and mobile use, with good SEO practices evident in meta tags and structured content. Security posture is adequate with HTTPS implied, but lacks visible security headers and explicit privacy or cookie policies, which are areas for improvement. The absence of WHOIS data raises some concerns about domain registration transparency, though the website content and branding strongly support legitimacy. Overall, the site is professional and trustworthy but would benefit from enhanced privacy compliance and security best practices.

40
35
17
60
42
75
100
lawfirmlegalservicesentertainmentindustryintellectualpropertylitigation+3 more
jwplayer 7.0.0Google Tag ManagerGoogle AnalyticsHTML5 video+2
2025-07-07T05:32:27.159Z
wwhgd.com favicon

Weinberg Wheeler

wwhgd.com

0
OtherUnited StatesmediumMEDIUM

Weinberg, Wheeler, Hudgins, Gunn & Dial, LLC is a national litigation law firm specializing in complex, high-exposure cases, particularly in construction law and catastrophic legal disputes. The firm positions itself as a bold and innovative advocate with extensive trial and arbitration experience across multiple states. Their website reflects a professional and polished digital presence, targeting corporate clients, insurance carriers, and legal professionals seeking expert litigation services. The firm emphasizes its strategic approach and proven track record through client testimonials and detailed service descriptions. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, WebP images for optimized media delivery, and HTML5 video content. The site is mobile-optimized with good accessibility and SEO practices. However, no CMS or hosting provider details are explicitly identified. Performance is moderate with room for improvement in security header implementation. From a security perspective, the site uses HTTPS and has a cookie consent mechanism aligned with privacy regulations, including GDPR compliance. However, no explicit security policies or incident response contacts are published, and security headers are not detected, which could be improved to enhance protection and trust. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness from a domain registration standpoint. Overall, the website is professional and trustworthy in content and design but would benefit from improved domain registration transparency and enhanced security practices to strengthen its risk posture and compliance stance.

55
68
17
70
72
80
100
lawfirmlitigationconstructionlawtrialadvocacylegalservices+3 more
Google AnalyticsGoogle Tag ManagerSlick CarouselCustom JavaScript+2
2025-07-07T05:32:22.151Z
irell.com favicon

Irell & Manella LLP

irell.com

0
OtherUnited StatesmediumMEDIUM

Irell & Manella LLP is a reputable law firm specializing in high-stakes business litigation, including patent litigation, securities fraud defense, and complex contract disputes. The firm is recognized for achieving exceptional client outcomes and holds ISO 27001 certification, underscoring its commitment to information security. The website presents a professional and well-structured digital presence targeting corporate clients and legal professionals. Technically, the website employs modern web technologies including Google Tag Manager for analytics and tracking, with good mobile optimization and accessibility features. The site uses HTTPS with an excellent SSL configuration, though security headers are not explicitly detected. Privacy compliance is strong with a comprehensive privacy policy and cookie consent mechanism. Security posture is solid, supported by ISO 27001 certification and secure website practices, but could be improved by adding visible security headers and publishing incident response or vulnerability disclosure information. The absence of WHOIS data is unusual but does not detract significantly from the site's legitimacy given the professional content and trust signals. Overall, the website is trustworthy, professional, and secure with minor areas for improvement in security transparency and contact information visibility.

40
53
17
65
72
80
100
lawfirmbusinesslitigationpatentlitigationiso27001legalservices
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:32:17.143Z