Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 137 of 206|Showing 6801-6850 of 10254
mcbrayerfirm.com favicon

McBrayer PLLC

mcbrayerfirm.com

0
OtherUnited StatesmediumMEDIUM

McBrayer PLLC is a well-established law firm serving the Kentucky business community since 1963. The firm offers a broad range of legal services including business and corporate law, real estate, healthcare, intellectual property, and employment law. It maintains a strong regional presence with offices in Lexington, Louisville, and Frankfort, and extends its reach nationally through memberships in global legal alliances such as Meritas and SCG Legal. The website reflects a professional and comprehensive presentation of their services, team, and industry involvement. Technically, the website employs modern analytics and marketing technologies including Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag. The site is served over HTTPS with good SSL configuration, though some security headers are missing. The site is moderately optimized for mobile and accessibility, with good SEO practices evident in metadata and structured navigation. However, there is no visible cookie consent mechanism, which may impact privacy compliance. From a security perspective, the site shows a solid baseline with HTTPS and no exposed sensitive data. The absence of certain security headers and lack of an incident response or vulnerability disclosure page suggest areas for improvement. The WHOIS data is notably missing or inaccessible, which is unusual for a firm of this stature and warrants further verification to confirm domain registration legitimacy. Overall, McBrayer PLLC’s website is professional, content-rich, and trustworthy, with moderate technical and security maturity. Strategic enhancements in privacy compliance and security headers would further strengthen their digital posture.

45
58
17
85
62
85
100
lawfirmlegalserviceskentuckybusinesslawlitigation+4 more
jwplayerGoogle Tag ManagerGoogle Analytics (gtag.js)Facebook Pixel+2

Partner Domains:

www.mmlkgov.com
partner
www.meritas.org
partner

+1 more partners

2025-07-07T00:59:55.347Z
giro.com favicon

Giro Sport Design

giro.com

0
E-commerceUnited StatesmediumMEDIUM

Giro Sport Design is a well-established company specializing in designing and selling cycling and snow sports gear, operating since 1985 from Santa Cruz, California. The website serves as an e-commerce platform offering a wide range of products including helmets, shoes, apparel, gloves, socks, goggles, and accessories for men, women, and kids. Giro targets enthusiasts in cycling and snow sports markets, maintaining a consistent and professional brand presence online. Technically, the website is built on the Salesforce Commerce Cloud platform (Demandware) and leverages modern web technologies including JavaScript, jQuery, Google Tag Manager, Google Analytics, Yotpo for reviews, and Signifyd for fraud protection. The site is mobile optimized, accessible, and SEO friendly, with good performance metrics. Privacy compliance is robust, featuring a comprehensive privacy policy, cookie consent via OneTrust, and GDPR adherence. From a security perspective, the site employs HTTPS with strong SSL configuration and security headers such as Content Security Policy and Strict-Transport-Security. Third-party integrations for fraud prevention and analytics are present, though no explicit security policy or incident response information is published. The absence of WHOIS data suggests domain privacy protection, which is justified for this business type. No vulnerabilities or suspicious domains were detected. Overall, Giro.com presents a secure, professional, and user-friendly e-commerce experience with strong privacy and compliance measures. Recommendations include publishing a dedicated security policy, incident response contacts, and vulnerability disclosure program to further enhance trust and security posture.

60
88
2
85
82
85
100
cyclingsnowsportse-commercesportsgearhelmets+2 more
JavaScriptjQueryGoogle Tag ManagerGoogle Analytics+3
2025-07-07T00:58:39.928Z
bellhelmets.com favicon

Bell Helmets

bellhelmets.com

0
RetailUnited StateslargeMEDIUM

Bell Helmets is a well-established company specializing in motorcycle, dirt bike, and bicycle helmets with a history dating back to 1954. The company operates a professional e-commerce platform powered by Salesforce Commerce Cloud, targeting motorcycle and bicycle enthusiasts including youth segments. Their market position is strong with a consistent brand presence and a comprehensive product offering including helmets, accessories, and apparel. The website is designed with a focus on user experience, mobile optimization, and clear navigation, supporting a broad audience in the transportation retail sector. Technically, the website employs modern analytics and marketing technologies such as Google Analytics, Bing Ads, Yotpo, and Signifyd for fraud prevention. The infrastructure is robust with HTTPS enforced and good performance metrics. Accessibility and SEO practices are well implemented, contributing to a positive digital maturity profile. From a security perspective, the site demonstrates good practices including secure forms with CSRF tokens, use of third-party fraud detection, and no visible vulnerabilities or exposed sensitive data. However, explicit security policies and incident response contacts are not published, representing an area for improvement. Privacy compliance is strong with clear privacy and cookie policies and consent mechanisms in place. Overall, Bell Helmets presents a low-risk profile with high business credibility and a secure, user-friendly online presence. Strategic recommendations include publishing a formal security policy, adding a vulnerability disclosure program, and enhancing visible security headers documentation to further strengthen trust and compliance.

60
53
2
80
72
85
100
motorcyclehelmetsbicycleecommerceretail+2 more
Google AnalyticsBing AdsGoogle Tag ManagerYotpo+4

Partner Domains:

vistaoutdoor.com
parent
revelyst.com
partner

+2 more partners

2025-07-07T00:58:09.878Z
flygainesville.com favicon

Gainesville Regional Airport

flygainesville.com

0
TransportationUnited StatesmediumHIGH

Gainesville Regional Airport operates as a regional transportation hub serving Gainesville, Florida, providing commercial airline services and general aviation amenities. The website presents a professional and consistent brand image, targeting travelers and visitors to the region. The business model focuses on facilitating air travel with key services including flight information, parking, and traveler support. The domain is well-established since 2001, reinforcing the airport's longstanding presence in the community. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and Revolution Slider, hosted by HostGator. The site demonstrates good mobile optimization and SEO practices, though performance is moderate. Accessibility features are basic but present. Analytics tools like Google Analytics and Tag Manager are used for user tracking, indicating moderate data collection. From a security perspective, HTTPS is properly implemented, and domain registration includes protective statuses. However, DNSSEC is not enabled, and no security headers were detected, which are areas for improvement. The absence of privacy and cookie policies reduces privacy compliance scores. No incident response or vulnerability disclosure information is published, which could impact trust. Overall, the website is safe, professional, and trustworthy, with room for enhancements in privacy compliance and security hardening. Strategic improvements in these areas will strengthen the airport's digital presence and user trust.

15
35
17
70
-
75
-
airportregionalairportflightstravelgainesville+2 more
WordPressYoast SEO pluginRevolution SliderjQuery+3

Partner Domains:

gra-gnv.com
partner
cedarkey.org
partner

+3 more partners

2025-07-07T00:56:49.107Z
auctiontime.com favicon

AuctionTime

auctiontime.com

0
TransportationUnited StateslargeMEDIUM

AuctionTime is a well-established online auction platform specializing in trucks, farm, and heavy equipment. It serves buyers and sellers primarily in the construction, agriculture, and trucking industries by providing a digital marketplace for auctioning new and used equipment. The platform is powered by Sandhills Global, a reputable parent company with multiple related brands in the heavy equipment and transportation sectors. AuctionTime offers comprehensive services including auction listings, bidding, consignment, financing, and market reports, positioning itself as a key player in its niche market. Technically, the website employs modern web technologies such as React and Material-UI, with integrations for Google Analytics and Tag Manager for tracking and marketing purposes. The site is mobile-optimized, accessible, and SEO-friendly, providing a professional and user-friendly experience. Security-wise, the site enforces HTTPS and implements cookie consent mechanisms, though it lacks explicit security headers and a published security policy or incident response page. The security posture is solid but could be improved by adding security headers and formalizing vulnerability disclosure and incident response information. Privacy compliance is strong, with clear privacy and cookie policies and GDPR considerations. The absence of WHOIS data reduces transparency but does not significantly detract from the site's credibility given its affiliation with Sandhills Global. Overall, AuctionTime presents a low-risk profile with a professional online presence, robust business model, and good technical implementation. Strategic improvements in security transparency and WHOIS data availability would further enhance trust and compliance.

20
100
17
92
75
85
100
onlineauctionsheavyequipmentfarmequipmenttruckstransportation+2 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

sandhills.com
parent
machinerytrader.com
subsidiary

+2 more partners

2025-07-07T00:56:29.043Z
controller.com favicon

Controller

controller.com

0
TransportationUnited StateslargeMEDIUM

Controller.com is a leading online marketplace specializing in the sale of new and used aircraft, including jets, turboprops, piston airplanes, helicopters, and related parts and equipment. The platform serves a broad audience of aircraft buyers, sellers, dealers, and aviation professionals, providing comprehensive listings across multiple aircraft categories and supporting services such as financing and dealer portals. The site is owned by Sandhills Global, a reputable parent company, which enhances its market credibility and operational scale. Technically, the website employs modern web technologies including React and Material UI, supported by Google Tag Manager and Analytics for performance monitoring and marketing. The site demonstrates good mobile optimization, accessibility, and SEO practices, contributing to a positive user experience. Advertising is managed primarily through Google AdSense and related networks, with transparent partner links and cross-promotions. From a security perspective, the site enforces HTTPS and employs some security best practices, though it lacks explicit security headers like Content-Security-Policy and X-Frame-Options. Privacy compliance is basic, with no explicit privacy or cookie policies detected in the provided content. The WHOIS data is unavailable or privacy protected, which slightly reduces transparency but does not detract significantly from the site's legitimacy given its professional presentation and parent company association. Overall, Controller.com presents a professional, trustworthy, and well-maintained platform for aircraft sales, with moderate room for improvement in privacy disclosures and security header implementation. Strategic enhancements in these areas would further strengthen its security posture and compliance standing.

20
100
17
95
57
85
100
aircraftmarketplaceaviationsalestransportation+1 more
ReactMaterial UIGoogle Tag ManagerGoogle Analytics+3

Partner Domains:

www.sandhills.com
parent
www.sandhillscloud.com
partner

+2 more partners

2025-07-07T00:56:24.034Z
tractorhouse.com favicon

Tractor House USA

tractorhouse.com

0
TransportationUnited StateslargeMEDIUM

TractorHouse.com is a specialized online marketplace and magazine platform dedicated to buying and selling new and used farm equipment in the United States. Operated by Tractor House USA, a service of Sandhills Global, the website offers a comprehensive catalog of agricultural machinery including tractors, harvesters, planting equipment, and attachments. The platform targets agricultural professionals and equipment dealers, providing detailed listings, market reports, and financing options to facilitate transactions. The business holds a strong market position as a leading resource in the agricultural equipment sector, supported by a consistent brand presence and extensive partner ecosystem. Technically, the website leverages modern web technologies including React and Material-UI for a responsive and accessible user experience. It integrates Google Tag Manager, Google Analytics, and Matomo for analytics and marketing, ensuring data-driven insights while maintaining user privacy through cookie consent mechanisms. The site demonstrates good SEO practices with structured data and meta tags, and it is optimized for mobile devices with clear navigation and fast loading times. From a security perspective, TractorHouse.com enforces HTTPS with strong SSL configuration and implements key security headers to protect users. No critical vulnerabilities or exposed sensitive data were detected. Privacy policies and cookie consent are present and GDPR compliant, though the site could improve by publishing explicit security policies and vulnerability disclosure information. The absence of WHOIS data is noted but does not detract from the overall legitimacy, given the strong business and technical indicators. Overall, TractorHouse.com presents a professional, secure, and user-friendly platform with a solid business foundation. Strategic recommendations include enhancing transparency around security policies, adding a vulnerability disclosure channel, and maintaining rigorous third-party script audits to sustain trust and compliance.

30
100
17
95
47
85
100
farmequipmentagriculturemarketplacetractorsusedequipment+3 more
ReactMaterial-UIGoogle Tag ManagerMatomo Analytics+3

Partner Domains:

sandhills.com
parent
livestockmarket.com
partner

+3 more partners

2025-07-07T00:56:14.018Z
machinerytrader.com favicon

MachineryTrader USA

machinerytrader.com

0
TransportationUnited StateslargeMEDIUM

MachineryTrader.com is a well-established online marketplace specializing in new and used construction equipment sales, parts, and attachments. Founded in 1978 and operated under the parent company Sandhills Global, Inc., the platform serves a broad audience of buyers and sellers in the heavy machinery and transportation sector. The website offers extensive listings, dealer directories, financing options, and market reports, positioning itself as a leading industry resource. Technically, the site leverages modern web technologies including React and Material-UI, with integration of Google Analytics and Tag Manager for performance and marketing insights. The site is well-optimized for mobile and accessibility, with strong SEO practices evident in metadata and structured data markup. Security posture is robust with HTTPS enforcement and security headers, though the absence of a dedicated security policy or incident response page suggests room for improvement. The lack of WHOIS domain registration data is a notable concern, potentially indicating privacy protection or domain registration issues, but the strong branding and parent company association mitigate trust concerns. Overall, MachineryTrader.com presents a professional, secure, and user-friendly platform with moderate risk due to incomplete domain registration transparency.

20
100
17
100
57
85
100
constructionequipmentmarketplaceheavymachineryusedequipment+2 more
ReactMaterial-UIGoogle Tag ManagerGoogle Analytics+2

Partner Domains:

sandhillscloud.com
partner
rvuniverse.com
partner
2025-07-07T00:56:09.007Z
uillinois.edu favicon

University of Illinois System

uillinois.edu

0
EducationUnited StatesenterpriseMEDIUM

The University of Illinois System website represents a major public higher education system in Illinois, encompassing three universities and a healthcare enterprise. It serves a broad audience including students, faculty, alumni, and the public, offering educational programs, research initiatives, healthcare services, and public engagement. The site is professionally designed with consistent branding and comprehensive content that highlights the system's impact, leadership, and priorities. Technically, the website is built on ASP.NET WebForms with Telerik UI components, integrating multiple analytics and marketing tools such as Google Analytics, Microsoft Clarity, Facebook Pixel, and Amazon Ads. The site is mobile-optimized and accessible, with good SEO practices and performance. Privacy and cookie policies are clearly presented with consent mechanisms, reflecting compliance with GDPR and other privacy standards. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. However, some security headers are not explicitly detected and incident response contacts or vulnerability disclosure mechanisms are not found, suggesting areas for improvement. The WHOIS data is unavailable, which is unusual but likely due to .edu domain registry policies. Overall, the domain and website appear legitimate and authoritative. Strategically, the site effectively communicates the system's mission, economic impact, and community engagement, supporting its position as a flagship educational institution. Recommendations include enhancing security headers, publishing a security.txt file, and improving incident response visibility to strengthen trust and security culture.

30
53
17
65
82
85
100
educationuniversityresearchhealthcarepublicservice+2 more
ASP.NET WebFormsTelerik UIGoogle Tag ManagerGoogle Analytics+6
2025-07-06T23:47:42.319Z
I

Illinois Department of Transportation

gettingaroundillinois.com

0
GovernmentUnited StateslargeMEDIUM

The website 'Getting Around Illinois' is an official government portal managed by the Illinois Department of Transportation (IDOT). It provides comprehensive transportation-related information including road construction, traveler information, commercial truck routes, and various interactive maps to assist residents and travelers in Illinois. The site is well-branded with official state logos and social media links to IDOT's verified accounts, reinforcing its legitimacy and trustworthiness. The business model is a public service aimed at providing timely and accurate transportation data to the public. Technically, the website employs a modern tech stack including Bootstrap for responsive design, jQuery, Font Awesome icons, DataTables for tabular data, and Adobe Dynamic Tag Management alongside Google Analytics for tracking and analytics. The site demonstrates good mobile optimization and a clear navigation structure, although SEO and accessibility features are basic. Performance is moderate, with no critical errors or broken elements detected. From a security perspective, the site uses HTTPS and has domain transfer protections in place, but lacks DNSSEC and visible security headers such as Content-Security-Policy or Strict-Transport-Security. There are no forms or inputs on the main page, reducing attack surface, but the absence of privacy and cookie policies indicates compliance gaps, especially regarding GDPR and user consent. No incident response or vulnerability disclosure information is provided. Overall, the website is a credible and professional government resource with a solid business foundation and good technical implementation. However, improvements in privacy compliance and security hardening are recommended to enhance user trust and regulatory adherence.

15
35
2
40
72
75
100
transportationgovernmentmapsroadconditionsillinois+1 more
BootstrapjQueryFont AwesomeDataTables+3
2025-07-06T23:47:37.310Z
sandhills.com favicon

Sandhills Global, Inc.

sandhills.com

0
TransportationUnited StateslargeMEDIUM

Sandhills Global, Inc. operates as a leading information processing company headquartered in Lincoln, Nebraska, specializing in connecting buyers and sellers across agriculture, construction, transportation, and aviation sectors. Their business model centers on gathering, processing, and distributing market information through multiple branded platforms, positioning them as a key player in equipment marketplaces worldwide. The website reflects a professional and consistent brand image with clear navigation and comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics, Google Tag Manager, and Font Awesome, ensuring good performance and mobile optimization. While no explicit CMS or hosting provider was identified, the site demonstrates good SEO and accessibility practices. However, some security best practices such as security headers and explicit cookie consent mechanisms could be improved. From a security perspective, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and a published security policy or incident response contacts. The WHOIS data is notably absent, which raises some concerns about domain registration transparency, although the website content and business presence strongly indicate legitimacy. Overall, the site maintains a solid security posture but would benefit from enhanced transparency and formal security disclosures. The overall risk assessment is moderate with recommendations focusing on improving security headers, publishing security policies, and enhancing privacy compliance mechanisms to strengthen trust and resilience against potential threats.

45
68
17
80
37
85
100
equipmentmarketplaceinformationprocessingtransportationconstructionaviation+3 more
Google AnalyticsGoogle Tag ManagerFont AwesomejQuery+1

Partner Domains:

machinerytrader.com
partner
tractorhouse.com
partner

+3 more partners

2025-07-06T22:41:57.691Z
tiffanyjphoto.com favicon

Tiffany J Photography

tiffanyjphoto.com

0
HospitalityUnited StatessmallMEDIUM

Tiffany J Photography is a boutique wedding and lifestyle photography business based in Los Angeles, established in 2013. The company specializes in heirloom-quality, fine art wedding photography, along with engagement, boudoir, and lifestyle photography services. The website reflects a strong market position with over a decade of experience and multiple press features, targeting engaged couples and individuals seeking professional photography in Southern California and beyond. The business model is service-oriented, focusing on personalized photography experiences and timeless imagery. Technically, the website is built on the Showit platform, utilizing jQuery and Animate.css for interactive and visual effects. Hosting is likely provided by GoDaddy, consistent with the domain registrar information. The site demonstrates good mobile optimization and SEO practices, though performance is moderate. Accessibility features are basic but present. Analytics are implemented via Google Analytics, indicating moderate user tracking. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks DNSSEC and security headers, which are recommended for enhanced protection. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism. Contact information is available primarily via email and contact forms, with no phone number listed. The domain registration data is consistent with the business claims, showing transparency and legitimacy. Overall, Tiffany J Photography's website is professional, trustworthy, and well-positioned in its niche, with opportunities to improve security headers and privacy compliance to enhance user trust and regulatory adherence.

15
53
17
70
95
85
100
weddingphotographylosangelesboudoirlifestyle+3 more
jQuery 3.5.1Showit platform scriptsAnimate.css
2025-07-06T22:40:57.474Z
archerypassport.com favicon

Archery Passport

archerypassport.com

0
OtherUnited StatessmallMEDIUM

Archery Passport is a small community-focused platform dedicated to raising awareness about archery opportunities in local communities. The website serves as an informational and engagement hub for archery enthusiasts, providing educational content such as how-to videos and an app login portal for members. The business operates primarily in the United States and targets archery hobbyists and local community members interested in the sport. Technically, the website is built on the Squarespace platform, leveraging modern web technologies including jQuery, Animate.css, WOW.js, and FontAwesome. The site is moderately optimized for performance and mobile responsiveness, with basic SEO and accessibility features. Google Analytics is integrated via Google Tag Manager for user tracking, though no cookie consent mechanism is present. From a security perspective, the site enforces HTTPS but lacks advanced security headers such as HSTS and Content Security Policy. There is no visible privacy policy, cookie policy, or incident response information, which indicates gaps in privacy compliance and security transparency. The domain registration uses privacy protection, which is reasonable for a small community platform, and no suspicious WHOIS patterns were detected. Overall, the website is functional and professionally designed but would benefit from enhanced privacy compliance, improved security headers, and clearer contact and policy information to strengthen trust and security posture.

35
53
17
60
85
65
100
archerycommunitysportseducationawareness
Squarespace CMSGoogle Tag ManagerjQueryAnimate.css+2
2025-07-06T22:40:42.447Z
vortexgolf.com favicon

Vortex Optics

vortexgolf.com

0
RetailUnited StatesmediumMEDIUM

Vortex Golf operates as a specialized e-commerce platform focused on golf laser rangefinders, apparel, and branded gear under the Vortex Optics brand. The company targets golf enthusiasts seeking precision equipment and branded merchandise, positioning itself as a niche leader in this segment. The website demonstrates a professional and consistent brand presence with clear navigation and relevant content tailored to its audience. Technically, the site is built on Magento 2, leveraging modern JavaScript libraries such as RequireJS and jQuery, and integrates advanced search capabilities via Algolia. It employs Google Tag Manager and New Relic for analytics and performance monitoring, indicating a mature digital infrastructure. Hosting appears to be on AWS, ensuring scalability and reliability. From a security perspective, the website enforces HTTPS, uses domain status locks to prevent unauthorized changes, and implements CAPTCHA on login forms. Cookie consent and privacy policies are in place, reflecting GDPR compliance. However, there is room for improvement by enabling DNSSEC and publishing explicit security policies or vulnerability disclosure mechanisms. Overall, the website is trustworthy, professionally maintained, and compliant with relevant privacy regulations. It provides a safe and user-friendly experience for its customers, with moderate tracking and analytics usage aligned with industry standards.

70
95
17
87
-
85
100
golfe-commercerangefinderslaserrangefindersgolfapparel+5 more
Magento 2RequireJSjQueryAlgolia Search+5

Partner Domains:

vortexoptics.com
parent
2025-07-06T22:39:47.885Z
aaflexington.com favicon

AAF Lexington

aaflexington.com

0
MediaUnited StatessmallMEDIUM

AAF Lexington is a local chapter of the American Advertising Federation dedicated to fostering the marketing and advertising community in Lexington, Kentucky. The organization offers professional networking, educational events, and industry recognition through signature events such as Advertising Underground, Ad Legends, and the American Advertising Awards. Their website reflects a well-structured and professionally designed platform that serves their members and the local creative community effectively. Technically, the website is built on WordPress and hosted on the WordPress.com platform, leveraging modern JavaScript libraries like jQuery and Owl Carousel for interactive content. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and SEO fine-tuning. The use of Jetpack and Mailchimp indicates integration with marketing and analytics tools, supporting community engagement and data-driven outreach. From a security perspective, the site enforces HTTPS and benefits from the secure hosting environment of WordPress.com. However, it lacks explicit security headers and published privacy or cookie policies, which are important for compliance and user trust. No incident response or vulnerability disclosure information is provided, representing an area for enhancement. Overall, the domain registration is consistent and trustworthy, with a long history matching the organization's founding date. The website content is safe for general audiences, with no adult or questionable material detected. Social media integration and testimonials add to the site's credibility and community feel. Strategic recommendations include publishing comprehensive privacy and cookie policies, implementing security headers, and providing clear incident response contacts to strengthen compliance and security posture.

30
35
17
55
75
80
100
advertisingmarketingnon-profiteventsnetworking+1 more
WordPressjQueryOwl CarouselJetpack+1
2025-07-06T22:39:37.853Z
downtownlex.com favicon

Downtown Lexington Partnership

downtownlex.com

0
Non-profitUnited StatesmediumHIGH

Downtown Lexington Partnership is a non-profit organization dedicated to promoting and enhancing the Downtown Lexington area as a vibrant community hub for living, working, and playing. The website serves as a comprehensive resource for residents, visitors, and businesses, offering event information, real estate listings, business directories, and community engagement opportunities. The organization positions itself as a key local leader in economic development and cultural promotion within Lexington, Kentucky. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Analytics, Google Tag Manager, and several plugins for events and forms. The site demonstrates good mobile optimization, clear navigation, and professional design, though some accessibility features could be improved. Performance is moderate, with use of CDNs and asynchronous loading of scripts. From a security perspective, the site enforces HTTPS and integrates Google reCAPTCHA for form protection, but lacks several important security headers such as Content-Security-Policy and X-Frame-Options. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is limited, with no explicit privacy or cookie policies found, which represents a compliance gap. The WHOIS data is missing or unavailable, which raises concerns about domain registration legitimacy despite the professional website presence. Overall, the website is a well-constructed community resource with strong business credibility and user experience. However, it should address privacy compliance and security header implementation, and verify domain registration status to enhance trustworthiness and reduce risk.

15
35
2
70
-
85
20
communityeventsrealestatelocalbusinessnon-profit+2 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+5

Partner Domains:

www.mcbrayerfirm.com
partner
www.visitlex.com
partner

+3 more partners

2025-07-06T22:39:22.812Z
commercelexington.com favicon

Commerce Lexington Inc.

commercelexington.com

0
Non-profitUnited StatesmediumCRITICAL

Commerce Lexington Inc. is a non-profit organization dedicated to supporting and advocating for businesses and organizations in Lexington, Kentucky, and the Central Kentucky region. Their services focus on economic development, minority business growth, leadership development, and advocacy at various government levels. The organization positions itself as a regional leader and a circle of influence for business growth and community support. The website reflects a professional and consistent brand image with clear navigation and relevant content for its target audience of business owners, entrepreneurs, and community leaders. Technically, the website is built on the EditMySite platform (a Weebly reseller), utilizing common web technologies such as jQuery, Google Analytics, Google Tag Manager, and Video.js for media content. The site is served over HTTPS with a good SSL configuration, though some modern security headers are missing. Performance is moderate with good mobile optimization and basic accessibility features. SEO is basic but present with meta tags and Open Graph data. From a security perspective, the site uses HTTPS and includes tracking scripts responsibly but lacks visible privacy and cookie policies, consent mechanisms, and security incident response information. No vulnerability disclosure or security.txt file is found. The WHOIS data is missing or indicates the domain may not be currently registered, which is a significant concern for domain legitimacy and trust. Overall, the website is professional and functional but would benefit from improved privacy compliance, enhanced security headers, and clarification of domain registration status to strengthen trust and security posture.

-
-
-
-
-
-
-
economicdevelopmentminoritybusinessleadershipdevelopmentadvocacynon-profit+3 more
Google AnalyticsGoogle Tag ManagerjQuery 1.8.3Video.js+2

Partner Domains:

locateinlexington.com
partner
commercelexington.mcjobboard.net
partner
2025-07-06T22:39:17.801Z
jokerwebhosting.com favicon

Joker Web Hosting

jokerwebhosting.com

0
TechnologyUnited StatessmallCRITICAL

Joker Web Hosting is a small technology company based in Lexington, KY, specializing in website hosting services tailored for entrepreneurs, small businesses, and e-commerce platforms. Their offerings include basic shared hosting, premium cloud hosting, managed WordPress hosting, and WooCommerce hosting, supported by expert customer service and daily backups. The company also operates a suite of related businesses providing web design, business solutions, payment processing, IT consulting, and advertising services, indicating a diversified service ecosystem. Technically, the website is built on WordPress using the Divi theme, leveraging modern web technologies such as jQuery, FontAwesome, and Google Fonts. The site is mobile-optimized, accessible, and SEO-friendly, with Google Analytics integrated for user tracking. SSL is properly configured with free Let’s Encrypt certificates, ensuring secure connections. However, the site lacks explicit cookie consent mechanisms and security headers, which are areas for improvement. From a security perspective, the site demonstrates good practices like HTTPS enforcement, firewall and DDoS protection on cloud plans, and regular backups. The absence of WHOIS registration data raises concerns about domain legitimacy and trustworthiness, although the website content and business information appear professional and consistent. No critical vulnerabilities or adult content were detected. Overall, Joker Web Hosting presents as a credible local hosting provider with a solid technical foundation and a broad service portfolio. Strategic enhancements in privacy compliance, security headers, and domain registration transparency would strengthen their security posture and trustworthiness.

-
-
-
-
-
-
-
webhostingcloudhostingwordpresshostinglexingtonkymanagedhosting+1 more
WordPressDivi ThemejQueryFontAwesome+3

Partner Domains:

jokerweb.design
partner
jokerbusiness.solutions
partner

+3 more partners

2025-07-06T22:39:05.783Z
jokerweb.design favicon

Joker Web Design

jokerweb.design

0
TechnologyUnited StatessmallMEDIUM

Joker Web Design is a small, professional web design and digital marketing agency based in Lexington, Kentucky. The company specializes in creating custom WordPress websites, SEO, web hosting, maintenance, and advertising services tailored to both small and large businesses. Their market position is focused on local clients with a strong emphasis on personalized service and client collaboration throughout the development process. The website reflects a consistent brand identity with good content quality and positive customer testimonials, indicating a trustworthy and credible business. Technically, the website is built on WordPress using the Divi theme and several modern plugins including Gravity Forms and WP Review Slider Pro. Hosting appears to be on Amazon AWS infrastructure, and the site employs HTTPS with a valid SSL certificate. SEO practices are well implemented with comprehensive metadata and structured data. Mobile optimization and user experience are good, though accessibility features are basic. Analytics are implemented via Google Analytics through MonsterInsights, with moderate user tracking. From a security perspective, the site uses HTTPS and Google reCAPTCHA on forms, but lacks visible security headers and does not have DNSSEC enabled. There are no explicit privacy or cookie policies found, which is a compliance gap especially for GDPR. The domain is privacy protected but registered since 2018, consistent with the business age and type. No suspicious or malicious indicators were found. Overall, the website is professional and functional with good business credibility but would benefit from improved privacy compliance and enhanced security headers to strengthen its security posture and regulatory adherence.

65
58
17
85
57
85
100
webdesigndigitalmarketingwordpressseolexingtonky+1 more
WordPressDivi ThemeGravity FormsGoogle Analytics (MonsterInsights)+3
2025-07-06T22:39:00.773Z
jokerit.consulting favicon

Joker IT Consulting

jokerit.consulting

0
TechnologyUnited StatessmallMEDIUM

Joker IT Consulting is a small IT and cybersecurity services company based in Lexington, Kentucky, founded in 2018. The company focuses on empowering small and medium-sized businesses by providing managed IT services, IT consultation, cybersecurity, network consulting, help desk support, cloud services, VoIP phone systems, and computer repair. The website reflects a professional and consistent brand image with clear contact information and a broad service portfolio, positioning the company as a trusted local IT partner. Technically, the website is built on WordPress using the Divi theme and several plugins including MonsterInsights for Google Analytics, DiviFlash, and accessibility tools. Hosting is likely on AWS infrastructure as indicated by DNS servers. The site is mobile optimized, accessible, and SEO friendly with structured data implemented for local business and organization information. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks explicit security headers and a cookie consent mechanism. Privacy policy is present but basic and does not explicitly address GDPR compliance. No incident response or vulnerability disclosure policies are found. The domain is privacy protected but consistent with the business location and age, indicating legitimacy. Overall, the website presents a trustworthy and professional IT consulting business with room for improvement in privacy compliance and security best practices. Strategic recommendations include enabling DNSSEC, adding security headers, implementing cookie consent, and enhancing privacy policy details to align with GDPR and other regulations.

65
53
47
70
57
80
100
manageditservicesitconsultationcybersecuritynetworkconsultinghelpdesksupport+7 more
WordPressDivi ThemeGoogle Analytics (MonsterInsights)FontAwesome+4

Partner Domains:

jokerpayments.com
partner
jokerweb.design
partner

+2 more partners

2025-07-06T22:38:55.573Z
vistaoutdoor.com favicon

TKG

vistaoutdoor.com

0
ManufacturingUnited StateslargeMEDIUM

The Kinetic Group is a large manufacturing company specializing in ammunition production and brand management, positioning itself as a world leader in the ammunition industry. The website showcases multiple well-known ammunition brands under its umbrella, targeting shooting sports enthusiasts and industry partners. The business model focuses on manufacturing and managing a portfolio of ammunition brands with a professional online presence. Technically, the website is built on the Demandware (Salesforce Commerce Cloud) platform, utilizing modern JavaScript libraries and embedded YouTube content. The site is mobile-optimized with good SEO and basic accessibility features. Performance is moderate, with room for improvement in accessibility and security headers. Security posture is solid with HTTPS enabled and no visible sensitive data exposure. However, the absence of security headers and explicit incident response policies indicates areas for enhancement. Privacy compliance is good, with comprehensive privacy and cookie policies and GDPR considerations. Overall, the website is professional and trustworthy, though the lack of WHOIS data reduces domain registration transparency. Strategic recommendations include improving security headers, adding incident response information, and enhancing accessibility to strengthen the security and compliance posture.

60
53
2
40
72
75
100
ammunitionmanufacturingfirearmsbrandscorporate+2 more
JavaScriptYouTube iframe APIDemandware (Salesforce Commerce Cloud)CQuotient tracking

Partner Domains:

vistaoutdoor.com
partner
2025-07-06T22:38:30.515Z
sezzle.com favicon

Sezzle

sezzle.com

0
FinanceUnited StateslargeLOW

Sezzle is a well-established financial technology company specializing in buy now, pay later services that enable consumers to split purchases into four interest-free installments over six weeks. The company positions itself as a responsible payment solution provider focused on empowering consumers financially and helping them build credit. With a strong market presence and a large user base, Sezzle offers key services including interest-free installment payments and merchant payment solutions. The website reflects a professional and trustworthy brand with excellent content quality and clear business messaging. Technically, the website is built using modern frameworks such as Gatsby and React, hosted on Amazon AWS infrastructure, and integrates third-party services like AppsFlyer for analytics and Trustpilot for customer reviews. The site demonstrates excellent performance, mobile optimization, and SEO practices, contributing to a positive user experience. Security measures include HTTPS enforcement and appropriate security headers, although a dedicated security policy or incident response page is not publicly available. The security posture is strong with no detected vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with comprehensive privacy and cookie policies, including consent mechanisms and GDPR compliance indicators. Business credibility is high, supported by clear contact information, trust signals, and consistent branding. The domain WHOIS data aligns with the company's history and legitimacy, showing no suspicious patterns. Overall, Sezzle's website is professional, secure, and compliant, making it a reliable platform for its financial services. Strategic recommendations include publishing a dedicated security policy, incident response contacts, and a vulnerability disclosure to further enhance transparency and trust.

80
58
17
82
100
85
100
buynowpaylaterfinancee-commerceinstallmentpaymentscreditbuilding+1 more
ReactGatsbyJavaScriptAppsFlyer+1
2025-07-06T22:38:05.415Z
illinois.gov favicon

State of Illinois

illinois.gov

0
GovernmentUnited StatesenterpriseMEDIUM

Illinois.gov is the official state government portal for the State of Illinois, providing residents, businesses, visitors, and government employees access to a wide range of services and information. The website serves as a centralized hub for state agency resources including road conditions, unemployment benefits certification, professional license lookups, state job listings, driver's license renewals, and sex offender location services. The site is positioned as the authoritative source for Illinois state government information and services, reflecting a strong market position within the public sector. Technically, the website is built on Adobe Experience Manager (AEM), leveraging modern web technologies including JavaScript, Adobe Launch for tag management, and Google Translate for multilingual support. The site integrates with Adobe Analytics and Siteimprove for performance and user behavior tracking. Hosting appears to be on government or cloud infrastructure with moderate performance and good mobile optimization and accessibility. From a security perspective, the site enforces HTTPS with strong SSL configuration and employs security best practices such as content security policies and secure form handling. However, there is no visible cookie consent mechanism or explicit security policy and incident response contact information published, which are areas for improvement. The WHOIS data is not publicly available, consistent with .gov domain privacy norms, and the domain appears legitimate and trustworthy. Overall, Illinois.gov demonstrates a mature digital presence with strong business credibility and technical implementation. Strategic recommendations include implementing a visible cookie consent banner to enhance privacy compliance, publishing clear security policies and incident response contacts, and adding a vulnerability disclosure or security.txt file to improve transparency and security posture.

60
53
2
70
85
80
100
governmentstateillinoisservicesofficial+2 more
Adobe Experience Manager (AEM)JavaScriptYouTube iframe APIGoogle Translate+2
2025-07-06T22:37:24.873Z