Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 169 of 206|Showing 8401-8450 of 10254
mondo.com favicon

Mondo National Staffing Agency

mondo.com

0
TechnologyUnited StateslargeMEDIUM

Mondo National Staffing Agency is a well-established staffing and recruiting firm specializing in IT, technology, digital marketing, and creative talent solutions. Founded in 1994 and operating under the Addison Group umbrella, Mondo holds a strong market position as a leading national staffing agency. Their website reflects a professional and comprehensive business model targeting both employers seeking talent and job seekers. The company offers specialized staffing services across digital marketing, IT/tech, and creative sectors, supported by a robust content strategy including blogs, videos, and hiring guides. Technically, the website is built on WordPress with modern JavaScript libraries and frameworks such as jQuery, Gravity Forms, and AOS for animations. It integrates Google Analytics and HubSpot for marketing and analytics purposes, alongside a cookie consent mechanism via CookieYes, indicating a mature digital infrastructure. The site is mobile-optimized, accessible, and SEO-friendly, with fast loading times and clear navigation. From a security perspective, the site uses HTTPS with a valid SSL certificate and enforces domain status protections to prevent unauthorized changes. However, DNSSEC is not enabled, and some recommended HTTP security headers are missing. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is well addressed with clear privacy and cookie policies, and GDPR compliance indicators are present. Overall, Mondo's website demonstrates a high level of professionalism, trustworthiness, and technical maturity. The domain's WHOIS data corroborates the business's legitimacy and long-standing presence. Strategic recommendations include enabling DNSSEC, enhancing HTTP security headers, and publishing explicit security policies or vulnerability disclosure information to further strengthen security posture and trust.

15
68
47
70
-
85
100
staffingrecruitingitstaffingdigitalmarketingcreativestaffing+3 more
jQueryGravity FormsAOS (Animate On Scroll)Superfish menu+5
2025-06-27T12:56:20.825Z
academyart.edu favicon

Academy of Art University

academyart.edu

0
EducationUnited StateslargeMEDIUM

Academy of Art University is a large, established educational institution specializing in art and design education. It offers over 900 courses including STEM-designated degrees and AI-infused courses, delivered both online and on campus. The university targets undergraduate and graduate students globally, emphasizing professional portfolio development and flexible learning options. The website reflects a mature digital presence with consistent branding and comprehensive course information. Technically, the site is built on WordPress with modern SEO and marketing integrations such as Yoast SEO, Google Tag Manager, and OneTrust for cookie consent. Hosting is provided by Pressidium, ensuring reliable performance. The site is mobile-optimized and uses responsive design techniques, though accessibility features are basic. From a security perspective, the website enforces HTTPS with strong SSL configuration and includes security headers. Cookie consent and input sanitization are implemented, but explicit security policies and incident response contacts are not found. No vulnerabilities or exposed sensitive data were detected. WHOIS data is unavailable due to .edu domain restrictions, but the site’s professionalism and social presence support its legitimacy. Overall, the website scores well in content quality, technical implementation, security posture, privacy compliance, and business credibility. Strategic recommendations include enhancing accessibility, publishing a security policy, and adding vulnerability disclosure information to further improve trust and compliance.

15
88
29
85
62
85
100
educationartdesignuniversityonlinecourses+2 more
WordPressYoast SEOGoogle Tag ManagerjQuery+2
2025-06-27T12:56:20.617Z
marketingassociates.com favicon

OneMagnify

marketingassociates.com

0
TechnologyUnited StatesmediumLOW

OneMagnify is a performance marketing and technology agency specializing in creating optimal customer experiences through digital transformation. The company offers a broad range of services including customer experience optimization, brand strategy, digital marketing, business intelligence, and eCommerce capabilities. Backed by Crestview Partners and having acquired Guidance, OneMagnify positions itself as a growing player in the digital marketing and technology sector, targeting businesses seeking to enhance their digital presence and operational impact. Technically, the website is built on the Webflow platform, leveraging modern web technologies and multiple analytics and marketing tools such as Google Analytics, Microsoft Clarity, Segment, Mouseflow, and HubSpot forms. The site demonstrates excellent mobile optimization, fast performance, and good SEO and accessibility practices, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS, employs standard security headers, and uses secure forms via HubSpot. However, there is no publicly available security policy, incident response information, or vulnerability disclosure program, which are areas for improvement. The absence of WHOIS data for the domain raises concerns about domain registration transparency, although the website content and branding appear professional and trustworthy. Overall, OneMagnify presents a strong digital and business presence with minor gaps in security transparency and domain registration information. Strategic recommendations include publishing security and incident response policies, establishing a vulnerability disclosure program, and improving domain registration transparency to enhance trust and compliance.

85
85
22
75
77
85
100
performancemarketingdigitaltransformationcustomerexperiencebrandstrategybusinessintelligence+3 more
Google Tag ManagerGoogle Analytics (gtag.js)Facebook Meta PixelMicrosoft Clarity+5

Partner Domains:

guidance.com
subsidiary
2025-06-27T12:56:19.925Z
linearistranslations.com favicon

Linearis

linearistranslations.com

0
OtherUnited StatesmediumMEDIUM

Linearis is a well-established language solutions provider specializing in translation, interpreting, and language technology services, with a strong market position in the Baltic region and global reach. The company offers a comprehensive portfolio of services including translation, editing, simultaneous and consecutive interpreting, multimedia translation, and advanced technology integrations such as machine translation post-editing and WordPress localization. The website reflects a mature digital presence with professional design, clear navigation, and multilingual support, indicating a high level of digital maturity. Technically, the website is built on WordPress with modern plugins like WPBakery, Yoast SEO, and WPML, supported by Cloudflare DNS and integrated with marketing and analytics tools such as Google Analytics, Hotjar, and MailerLite. Performance and mobile optimization are good, with SEO and accessibility features well implemented. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though explicit security headers could be improved. The security posture is strong with no detected vulnerabilities or exposed sensitive data. Privacy compliance is good, with clear privacy and cookie policies and GDPR compliance indicators. Contact information is readily available, enhancing business credibility. The domain uses privacy protection but aligns with the business profile, and the domain age is reasonable given possible rebranding. Overall, Linearis.io presents a trustworthy, professional, and secure online presence suitable for its business model. Strategic recommendations include enhancing security headers, maintaining up-to-date software, and continuing to monitor privacy compliance to sustain trust and security.

30
73
47
80
72
85
100
translationlanguagesolutionsinterpretinglocalizationmachinetranslation+1 more
WordPressWPBakery Page BuilderYoast SEOGoogle Tag Manager+4
2025-06-27T12:56:19.799Z
interimhealthcare.com favicon

Interim HealthCare

interimhealthcare.com

0
HealthcareUnited StateslargeMEDIUM

Interim HealthCare is a well-established home healthcare agency operating since 1966, providing personalized home health care, hospice, personal care, and medical staffing services across the United States. The company operates a franchise model with over 300 locations in 44 states, emphasizing patient-centered and holistic care. Their website reflects a mature digital presence with comprehensive service descriptions, career opportunities, and resources for clients and healthcare partners. Technically, the website employs modern JavaScript libraries such as jQuery and Modernizr, integrates Google Tag Manager and Microsoft Clarity for analytics, and uses HTTPS with good SSL configuration. The site is mobile-optimized, accessible, and SEO-friendly, offering a positive user experience. However, no explicit CMS or hosting provider information is discernible. From a security perspective, the site enforces HTTPS and uses cookie consent mechanisms, but lacks visible security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected in the HTML content. The absence of WHOIS data is a notable anomaly but does not undermine the site's legitimacy given the professional branding and business information. Overall, the website demonstrates a strong business credibility and technical maturity with room for improvement in security transparency and WHOIS data availability. Strategic recommendations include implementing security headers, publishing a security policy, and clarifying domain registration details to enhance trust and compliance.

50
53
17
70
75
75
100
homehealthcarepersonalcarehospicemedicalstaffinghealthcareservices+2 more
jQuery 3.6.0ModernizrGoogle Tag ManagerMicrosoft Clarity+1

Partner Domains:

www.interimfranchising.com
partner
2025-06-27T12:56:19.477Z
D

Domains By Proxy, LLC

videodone.io

0
OtherUnited StatessmallHIGH

The website videodone.io operates as an adult content affiliate platform, primarily linking to third-party adult image galleries. It targets adult users interested in explicit content, leveraging affiliate marketing to monetize traffic. The site lacks direct business transparency, with domain registration protected by a privacy service, and no clear company contact information or policies presented on the site. The business model is typical for small-scale adult affiliate sites, focusing on volume of external links rather than original content creation. Technically, the site uses basic web technologies including JavaScript and CSS with Google Fonts, hosted via GoDaddy. The site is served over HTTP without HTTPS, lacks modern security headers, and includes a pop-under ad script that opens a suspicious external domain, raising security concerns. The site’s design and user experience are poor, with minimal mobile optimization and accessibility features. SEO practices are basic, with minimal metadata and no structured data. From a security perspective, the absence of HTTPS and security headers, combined with the presence of potentially malicious pop-under scripts, significantly lowers the security posture. There is no evidence of privacy or cookie policies, nor GDPR compliance mechanisms. Incident response contact is limited to an abuse removal link, with no dedicated security or data protection contacts. These factors collectively indicate a high risk for users and low trustworthiness. Overall, the site scores poorly on content quality, technical implementation, security, privacy compliance, and business credibility. Strategic improvements are necessary to enhance security, transparency, and user trust, including enabling HTTPS, implementing security headers, providing clear privacy and cookie policies, and removing suspicious scripts.

15
10
-
85
-
50
20
adultpornaffiliateimagegalleriesteen+1 more
JavaScriptCSSGoogle Fonts
2025-06-27T12:56:19.317Z
dripit.io favicon

dripit

dripit.io

0
TechnologyUnited StatessmallMEDIUM

Dripit.io is a newly established technology startup founded in 2023, focused on discovering new music trends and predicting hype within the music industry. The website is minimalistic, primarily serving as a landing page with basic metadata and Open Graph tags describing its purpose. The business model appears to center around providing insights or analytics related to music trends, targeting music enthusiasts and trend followers. The company operates under privacy protection for its domain registration, which is common for early-stage startups but limits transparency. Technically, the website uses modern JavaScript modules and is hosted on Amazon AWS infrastructure, indicating a scalable and reliable hosting environment. However, the site lacks comprehensive SEO optimization, accessibility features, and mobile responsiveness is basic. No content management system or advanced frameworks are detected, suggesting a lightweight custom build. Performance is moderate given the minimal content. From a security perspective, the site uses HTTPS but does not have DNSSEC enabled, and no security headers were detected in the provided data. There are no visible forms or user input fields, reducing immediate attack surface, but the absence of privacy and cookie policies indicates non-compliance with GDPR and related regulations. No incident response or security contact information is provided, which is a gap for transparency and trust. Overall, the website is functional but minimal, with significant room for improvement in privacy compliance, security posture, and content richness. The domain's privacy protection and new registration date are consistent with a startup phase but reduce trust signals. Strategic recommendations include implementing privacy and cookie policies, enabling DNSSEC, adding security headers, and providing clear contact and incident response information to enhance credibility and compliance.

15
40
2
70
77
80
100
musictrendstechnologystartupprediction
JavaScript ES Modules
2025-06-27T12:56:19.310Z
R

RBDS Rubbish Boys Disposal Service Inc.

1800gotjunk.com

0
TransportationUnited StateslargeMEDIUM

1-800-GOT-JUNK? operates as a leading full-service junk removal company in the United States, providing residential and commercial junk pickup with a strong emphasis on customer convenience, sustainability, and professional service. The company leverages a franchise business model under the parent company O2E Brands, with subsidiaries including WOW 1 DAY PAINTING and Shack Shine. Their market position is reinforced by extensive verified customer reviews and a high average rating, indicating strong brand trust and customer satisfaction. The website reflects a mature digital presence with modern technologies such as Next.js and Drupal headless CMS, ensuring fast performance and excellent mobile optimization. Privacy and cookie policies are comprehensive and GDPR compliant, with clear consent mechanisms in place. Security posture is strong with HTTPS enforcement and security headers, though no explicit incident response or vulnerability disclosure policies are publicly available. Overall, the business demonstrates a professional and trustworthy online presence with room for improvement in transparency of domain registration and security policy documentation.

70
68
2
75
95
80
100
junkremovalfull-servicefranchisecustomerreviewsrecycling+3 more
Next.jsReactVisual Website Optimizer (VWO)Google Tag Manager+1

Partner Domains:

www.o2ebrands.com
parent
www.wow1day.com
subsidiary

+1 more partners

2025-06-27T12:56:19.301Z
B

B.F. Fields Moving & Storage

jhbennett-moving.com

0
TransportationUnited StatesmediumHIGH

B.F. Fields Moving & Storage is a well-established moving and storage company based in Erie, Pennsylvania, with a history dating back to 1905. The company offers a comprehensive range of services including household relocation, office and industrial moving, warehousing, storage, and logistics. They maintain a strong market position locally and nationally through their partnership with North American Van Lines and certifications from industry bodies such as the American Moving & Storage Association and the Better Business Bureau. The website is professionally designed, mobile-optimized, and provides clear navigation and contact information, supporting a positive user experience. From a technical perspective, the website employs modern tracking and marketing technologies including Google Analytics, Google Tag Manager, and Podium widgets. The site is served over HTTPS with secure forms, indicating a good baseline security posture. However, the absence of security headers and privacy/cookie policies suggests areas for improvement in compliance and security best practices. The WHOIS data for the domain is missing, which raises questions about domain registration transparency but does not necessarily undermine the business legitimacy given the detailed content and certifications presented. Security-wise, the site shows no immediate vulnerabilities or exposed sensitive data, but lacks published incident response or vulnerability disclosure policies. The use of secure forms and HTTPS is positive, yet the lack of privacy and cookie policies indicates potential GDPR compliance gaps. Overall, the security posture is moderate with room for enhancement in policy transparency and header implementation. The overall risk assessment is moderate; the business appears credible and professional, but the missing WHOIS data and privacy compliance gaps should be addressed to strengthen trust and regulatory adherence. Strategic recommendations include publishing privacy and cookie policies, implementing security headers, and providing clear incident response contacts to improve security culture and compliance.

20
35
2
75
62
80
20
movingstoragelogisticseriepatransportation+2 more
Google AnalyticsGoogle Tag ManagerGoogle AdWordsPodium widget+1

Partner Domains:

northamerican.com
partner
2025-06-27T12:56:19.264Z
champick.com favicon

DomainMarket.com

champick.com

0
E-commerceUnited StatesmediumMEDIUM

DomainMarket.com operates as a premium domain marketplace specializing in the sale of high-quality .com domains such as Champick.com, targeting retail and e-commerce businesses. The company positions itself as a market leader with a large inventory and a proven track record of domain sales. Their business model revolves around one-time domain purchases with subsequent annual renewals handled by buyers. The website is professionally designed, mobile-optimized, and provides clear contact channels including phone, email, and inquiry forms, enhancing customer trust and engagement. Technically, the site leverages modern web technologies including Google Tag Manager, Hotjar, FullStory, and SpamKill for analytics, user experience, and security. The use of Alpine.js and Livewire indicates a dynamic and responsive front-end framework. While the site performs moderately well, there is room for improvement in security headers and cookie consent mechanisms to enhance privacy compliance. From a security perspective, the site enforces HTTPS and employs spam protection on forms, but lacks explicit security headers and a published security policy or incident response information. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data is noted but likely due to privacy or registry restrictions rather than malicious intent. Overall, the site demonstrates a strong security posture with minor gaps. Strategically, the site is low risk with a high trustworthiness rating. Recommendations include implementing security headers, adding cookie consent banners, publishing security policies, and auditing third-party scripts regularly to maintain compliance and security standards.

35
53
17
80
75
80
100
premiumdomainsdomainmarketplacee-commerceretaildomainsales+1 more
Google Tag ManagerGoogle Analytics (gtag.js)HotjarFullStory+3

Partner Domains:

infusionsoft.com
partner
createsend.com
partner

+1 more partners

2025-06-27T12:56:19.006Z
sca.coffee favicon

Specialty Coffee Association

sca.coffee

0
Non-profitUnited StateslargeMEDIUM

The Specialty Coffee Association is a well-established nonprofit organization founded in 2016, serving a global community of coffee professionals including producers, baristas, and industry stakeholders. The organization offers membership services, education, events, research, and sustainability initiatives, positioning itself as a key player in the specialty coffee industry. The website reflects a professional and consistent brand image, targeting coffee professionals worldwide. Technically, the site is built on the Squarespace platform, leveraging modern web technologies and standard tracking tools such as Google Tag Manager, Facebook Pixel, and LinkedIn Insights. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. Security-wise, the site enforces HTTPS and uses a cookie consent mechanism via OneTrust, but lacks advanced security headers and DNSSEC, which are recommended for improved security posture. No critical vulnerabilities or exposed sensitive data were detected. Overall, the domain registration is privacy-protected but justified for a nonprofit entity, with no suspicious patterns identified. Strategic recommendations include enhancing security headers, enabling DNSSEC, and publishing explicit privacy and security policies to improve trust and compliance.

35
88
2
80
62
85
100
nonprofitcoffeemembershipeducationevents+2 more
Squarespace CMSJavaScriptjQueryOneTrust Cookie Consent+4

Partner Domains:

specialtycoffee.my.site.com
service
education.sca.coffee
partner
2025-06-27T12:56:18.194Z
lakesunapee.org favicon

Lake Sunapee Protective Association (LSPA)

lakesunapee.org

0
Non-profitUnited StatessmallMEDIUM

The Lake Sunapee Protective Association (LSPA) is a well-established non-profit organization dedicated to the stewardship and protection of the Lake Sunapee Watershed since 1898. The organization focuses on watershed management, education, scientific research, invasive species control, and community advocacy. Their website reflects a strong commitment to environmental conservation and community engagement, targeting local residents, property owners, and environmental advocates. The business model relies on membership and donations, supported by volunteer efforts and educational outreach. Technically, the website is built on the Squarespace platform, leveraging modern web technologies such as HTTPS with HSTS, jQuery, Google reCAPTCHA, and Constant Contact for email marketing. The site is mobile-optimized with good navigation and content structure, though accessibility features could be enhanced. Performance is moderate, typical for a CMS-based site with rich media content. From a security perspective, the site enforces HTTPS with HSTS and uses reCAPTCHA to protect forms, indicating a good baseline security posture. However, the absence of additional security headers and lack of visible privacy and cookie policies represent compliance and security gaps. The WHOIS data is unavailable or protected, which reduces domain trustworthiness despite the professional appearance and long history claimed by the organization. Overall, the website is a credible and professional digital presence for a small non-profit environmental organization. Strategic improvements in privacy compliance, security headers, and WHOIS transparency would enhance trust and regulatory adherence.

35
35
2
40
62
70
100
non-profitenvironmentlakestewardshipeducationcommunity+2 more
SquarespacejQueryGoogle reCAPTCHAConstant Contact+2
2025-06-27T12:56:18.193Z
statelocalgov.net favicon

Johnsco LLC

statelocalgov.net

0
GovernmentUnited StatessmallMEDIUM

StateCity.ai is an online informational directory focused on providing comprehensive access to state and local government resources, business guides, and car insurance information across the United States. The platform aggregates links and topic pages to assist users in navigating government services and insurance options at both state and local levels. The business operates under Johnsco LLC, a US-based entity, and targets individuals and businesses seeking localized government and insurance information. The website content is basic but relevant, with a straightforward navigation structure and moderate mobile optimization. Technically, the website uses standard HTML, CSS, and JavaScript with Cloudflare DNS services. The site lacks advanced frameworks or CMS indications and shows basic performance and SEO optimization. Mobile responsiveness and accessibility are present but minimal. Security posture is moderate with HTTPS enabled but lacks DNSSEC, security headers, and published security or privacy policies. The domain WHOIS data presents a notable anomaly with a future creation date, which raises concerns about registration legitimacy. Overall, the website is functional and provides useful content but requires significant improvements in privacy compliance, security best practices, and domain legitimacy verification. The absence of contact information and security policies limits trustworthiness. Strategic enhancements in these areas will improve user confidence and regulatory compliance.

15
50
17
55
65
65
100
governmentinsurancebusinessstateresourcescarinsurance+1 more
HTMLCSSJavaScriptCloudflare DNS
2025-06-27T12:56:18.004Z
tpco.com favicon

The Preiss Company

tpco.com

0
Real EstateUnited StateslargeHIGH

The Preiss Company is a well-established leader in the ownership and management of multifamily and student housing communities across the United States. Positioned as one of the top 10 off-campus student housing providers nationally and the largest woman-owned operator in this sector, the company offers a comprehensive portfolio and investment platform focused on delivering superior living experiences. Their website reflects a professional and consistent brand image, targeting students, property investors, and housing clients with clear service offerings and extensive portfolio showcases. Technically, the website employs modern JavaScript libraries, Google Analytics, and Google Tag Manager for tracking, hosted on DigitalOcean infrastructure with a CMS powered by Resite. The site is mobile-optimized with good SEO and accessibility basics, though some improvements are possible. Security posture is moderate; HTTPS is used, but DNSSEC is not enabled and no explicit security headers were detected. Privacy compliance is basic with a cookie consent banner and privacy policy present, but no GDPR-specific indicators or data protection officer information. Overall, the domain registration is consistent and trustworthy, supporting the company's legitimacy. Strategic improvements in security policies and technical hardening would enhance trust and compliance.

15
53
2
55
57
80
40
studenthousingpropertymanagementrealestatemultifamilyhousingoff-campushousing+1 more
jQuery 3.7.0OwlCarousel 2.3.4Google AnalyticsGoogle Tag Manager+4
2025-06-27T12:56:17.667Z
lokalise.co favicon

Lokalise Inc.

lokalise.co

0
TechnologyUnited StatesmediumMEDIUM

Lokalise Inc. operates a SaaS localization and translation management platform designed to integrate seamlessly into software development workflows, enabling faster delivery of localized products. The company is positioned as a user-friendly solution targeting developers, product teams, and localization managers. Founded in 2016 and based in the USA, Lokalise maintains a medium-sized business profile with a consistent brand presence and good content quality on its website. Technically, the website leverages modern JavaScript technologies, including Google Tag Manager, Visual Website Optimizer, and OneTrust for cookie consent management. Hosting is provided via Amazon AWS infrastructure, ensuring reliable performance and scalability. The site demonstrates good mobile optimization and basic accessibility features, with SEO best practices implemented through meta tags and structured data. From a security perspective, the website employs HTTPS and domain transfer protection, but lacks DNSSEC and explicit security headers. No published security policies or incident response contacts were found, indicating room for improvement in transparency and security governance. Privacy compliance is partially addressed through cookie consent mechanisms, but the absence of a visible privacy policy and terms of service reduces compliance confidence. Overall, Lokalise presents a credible and professional online presence with moderate security posture and technical maturity. Strategic enhancements in privacy documentation, security policy publication, and DNS security would strengthen trust and compliance.

65
88
17
85
-
85
100
localizationtranslationsaastechnologysoftware+1 more
JavaScriptGoogle Tag ManagerVisual Website Optimizer (VWO)OneTrust Cookie Consent+1
2025-06-27T12:56:17.254Z
korin.com favicon

Korin, Inc

korin.com

0
RetailUnited StatesmediumHIGH

Korin, Inc is a specialized e-commerce retailer focused on professional quality Japanese chef knives, tableware, kitchenware, and restaurant supplies. Established in 1982, the company serves professional chefs, restaurants, and culinary enthusiasts worldwide, offering a wide range of imported Japanese knives, sharpening stones, kitchen tools, and barware. The website demonstrates a strong market position in the niche culinary supply sector with worldwide shipping and additional services such as knife sharpening and custom engraving. Technically, the website is built on the NetSuite SuiteCommerce platform, utilizing modern JavaScript libraries and frameworks such as RequireJS and jQuery. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features could be improved. The technical infrastructure appears stable and professional, supporting a seamless user experience. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks visible security headers and explicit incident response or vulnerability disclosure information. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, though the website content and business presence appear credible. Overall, Korin.com is a professional and trustworthy e-commerce site with strong business credibility and good technical implementation. Addressing domain registration transparency, enhancing privacy compliance, and improving security headers would further strengthen its security posture and trustworthiness.

-
35
17
70
-
80
100
japanesekniveskitchenwaretablewarerestaurantsuppliese-commerce+1 more
JavaScriptAJAXRequireJSjQuery+2
2025-06-27T12:56:16.985Z
ziegler.com favicon

B.C. Ziegler and Company

ziegler.com

0
FinanceUnited StateslargeMEDIUM

B.C. Ziegler and Company operates as a specialty investment bank focusing on healthcare, senior living, education, and municipal finance sectors. The firm provides capital raising, strategic advisory, sales and trading, and proprietary investments. It holds a strong market position with top rankings in senior living financing and healthcare M&A. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to institutional clients and municipal entities. Technically, the website employs modern tracking and analytics tools such as Google Tag Manager and Hotjar, uses lazy loading for images, and is built on a SiteBuilder CMS platform. The site is mobile optimized and accessible, with good SEO practices. However, there is room for improvement in security headers and privacy compliance mechanisms. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data raises some concerns but is mitigated by the presence of regulatory trust signals and professional content. Privacy compliance could be enhanced by implementing cookie consent banners and publishing incident response contacts. Overall, the website and business demonstrate a high level of professionalism and trustworthiness, suitable for their target market. Strategic improvements in privacy and security transparency would further strengthen their risk profile and compliance stance.

55
53
2
65
-
85
100
investmentbankinghealthcarefinanceseniorlivingfinancingcapitalmarketsfhahudmortgagelending+2 more
Google Tag ManagerHotjarSlick CarouselLazyLoad images
2025-06-27T12:56:16.981Z