Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 62 of 107|Showing 3051-3100 of 5311
pozyczkaportal.pl favicon

PERSKIMEDIA Szymon Perski

pozyczkaportal.pl

0
FinancePolandsmallMEDIUM

Pozyczkaportal.pl is a Polish online financial comparison portal specializing in loans and credit products. Established in 2014 and operated by PERSKIMEDIA Szymon Perski, the website offers comprehensive loan rankings, user reviews, financial calculators, and promotional offers. It targets Polish consumers seeking convenient online access to various loan and credit options, including non-bank loans and bank credits. The business model centers on providing comparison and referral services to facilitate informed financial decisions. Technically, the website is built on WordPress CMS with a modern tech stack including Yoast SEO Premium for search optimization, jQuery for interactivity, and Rocket Lazy Load for performance enhancement. Google Tag Manager is used for analytics and marketing tracking. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with some lazy loading of scripts and images. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks DNSSEC protection. No advanced security headers were detected, and there is no visible security or incident response policy. Cookie consent is implemented via an external script, indicating some level of privacy compliance. No direct contact information or privacy policy pages were found in the provided content, which is a gap in compliance and user trust. Overall, Pozyczkaportal.pl presents a professional and content-rich platform with moderate technical maturity and a generally good security posture. To enhance trust and compliance, it should publish explicit privacy and terms of service documents, improve security headers, and provide clear contact and incident response information.

55
25
17
70
62
75
100
financeloanscreditscomparisonpoland+3 more
WordPress 6.7.2Yoast SEO PremiumjQuery 3.7.1Rocket Lazy Load Scripts+4
2025-07-23T12:03:14.927Z
viaconto.se favicon

ViaConto Sweden AB

viaconto.se

0
FinanceSwedensmallMEDIUM

ViaConto Sweden AB operates an online lending platform offering flexible personal loans up to 20,000 SEK for new customers, with quick approval and no hidden fees. The company targets Swedish consumers seeking fast and flexible credit solutions. Their business model centers on providing a credit line with adjustable limits and flexible repayment options, leveraging digital identification via BankID for secure customer verification. The website is professionally designed, mobile-optimized, and includes clear legal and contact information, enhancing user trust and experience. Technically, the site employs modern JavaScript libraries such as jQuery, integrates analytics tools like Google Analytics and Microsoft Clarity, and uses Google Tag Manager for marketing management. The presence of BankID integration indicates a focus on secure digital identity verification. Performance is moderate with good mobile responsiveness, though accessibility could be improved. SEO practices are adequate with proper meta tags and structured navigation. From a security perspective, the website enforces HTTPS and uses trusted SSL certificates, displaying security badges to reassure users. However, it lacks explicit security headers and published security policies or incident response contacts, which are recommended for enhanced security posture. Cookie consent mechanisms are implemented, supporting GDPR compliance. No vulnerabilities or exposed sensitive data were detected in the analysis. Overall, ViaConto presents a credible and professional online lending service with a solid digital presence. The main risk lies in the absence of WHOIS data for the exact domain queried, which limits full verification of domain legitimacy. Strategic improvements in security transparency and accessibility would further strengthen their position and user trust.

70
10
2
70
75
70
100
loansfinancesmslnsnabblncredit+3 more
jQueryGoogle Tag ManagerMicrosoft ClarityTrustpilot widget+1
2025-07-23T09:49:53.738Z
viainvest.com favicon

VIAINVEST

viainvest.com

0
FinanceLatviamediumMEDIUM

VIAINVEST is a regulated European investment platform specializing in peer-to-peer lending and asset-backed securities, primarily backed by non-banking loans from VIA SMS Group. Founded in 2010 and headquartered in Latvia, the platform targets retail and institutional investors seeking alternative investment opportunities in the finance sector. The website presents a professional and consistent brand image, with a clear focus on regulated investment services and compliance with European financial regulations. Technically, the website employs a modern React-based frontend with Ant Design components, supported by robust third-party services including Google Analytics, Microsoft Clarity, and Cookiebot for consent management. Hosting and DNS services are provided by Cloudflare, ensuring good performance and security. The site is mobile-optimized and SEO-friendly, with comprehensive cookie consent mechanisms and privacy policies that align with GDPR requirements. From a security perspective, VIAINVEST enforces HTTPS and uses Cloudflare for DNS and potential DDoS protection. While some security headers are not explicitly visible in the HTML, the overall SSL configuration is good. The absence of DNSSEC is a minor security gap. No vulnerability disclosure or incident response information is publicly available, which could be improved. The domain registration data is consistent and trustworthy, supporting the legitimacy of the business. Overall, VIAINVEST demonstrates a solid security posture and compliance framework suitable for a regulated financial platform. The website is accessible without WAF challenges or blocking, and content safety is rated as safe with no adult or NSFW material. Strategic recommendations include enabling DNSSEC, publishing a security policy and vulnerability disclosure, and enhancing security headers to further strengthen the platform's security and trustworthiness.

70
83
2
85
85
85
100
investmentpeertopeerlendingp2plendingfinanceregulated+2 more
React 18Ant Design 5.10.0Axios 1.5.1Day.js 1.11.10+3
2025-07-23T08:38:53.639Z
gainlinecapital.com favicon

Gainline Capital Partners

gainlinecapital.com

0
FinanceUnited StatessmallMEDIUM

Gainline Capital Partners is a middle-market private equity firm focused on providing financial, operational, and strategic resources to middle-market companies primarily in North America. Founded in 2015, the firm targets control or majority investments in sectors including business services, niche manufacturing, consumer, logistics, transportation, and energy. The website reflects a professional and consistent brand image, emphasizing founder-friendly and first institutional capital positioning. The firm showcases a portfolio of investments and testimonials from CEOs of portfolio companies, reinforcing credibility and trust. Technically, the website uses a modern tech stack including Bootstrap 4.5.3, jQuery, and FontAwesome, hosted on Hover.com nameservers. The site is mobile optimized with good SEO practices but lacks a CMS and advanced accessibility features. Performance is moderate with no critical technical issues detected. However, the absence of DNSSEC and security headers indicates room for security improvements. From a security perspective, the domain is well-registered with long-term expiry and protective domain status flags. The website uses HTTPS as indicated by canonical links and external resources. However, no explicit security policies, incident response contacts, or privacy and cookie policies are present, which are important for compliance and user trust. No WAF or blocking mechanisms were detected, and no vulnerabilities or exposed sensitive data were found in the content. Overall, the website presents a trustworthy and professional business presence with moderate technical maturity and some compliance gaps. Strategic improvements in privacy, cookie management, and security headers would enhance the security posture and regulatory compliance, further strengthening business credibility.

15
35
17
85
72
80
100
middle-marketprivateequityinvestmentsbusinessservicesnichemanufacturing+5 more
Bootstrap 4.5.3jQuery 3.5.1FontAwesome 6.7.2Google Fonts (Source Sans Pro, Source Serif Pro)
2025-07-22T22:29:01.648Z
balancepointcapital.com favicon

Balance Point Capital Advisors, LLC

balancepointcapital.com

0
FinanceN/amediumMEDIUM

Balance Point Capital Advisors, LLC is a registered investment advisory firm specializing in providing flexible capital solutions including debt and equity financing to portfolio companies and investment partners. The firm emphasizes customized financing structures tailored to company needs, focusing on flexibility, partnership, and patience. With over $2.1 billion in capital commitments and more than 100 investments, Balance Point Capital holds a solid position in the mid-market investment space. The website reflects a professional and consistent brand image, targeting businesses seeking capital investment solutions. Technically, the website employs modern front-end technologies such as Bootstrap, jQuery, FontAwesome, and Slick Carousel, delivering a responsive and user-friendly experience. Hosting and domain registration are stable and consistent with the business profile. However, there is room for improvement in accessibility and SEO optimization. The site lacks advanced CMS or platform indicators, suggesting a custom or lightweight implementation. From a security perspective, the site uses HTTPS and has no visible exposed sensitive data, but lacks explicit security headers and publicly disclosed security policies. There is no cookie consent mechanism, which may impact privacy compliance. WHOIS data indicates a legitimate and well-maintained domain with no privacy protection, consistent with the business claims. Overall, the security posture is moderate but could be enhanced with better header implementation and privacy controls. The overall risk assessment is low, with no critical vulnerabilities detected. Strategic recommendations include implementing security headers, adding cookie consent for compliance, publishing security and incident response policies, and improving accessibility and SEO. These steps will enhance trust, compliance, and security culture, supporting the firm's professional image and operational resilience.

15
53
2
85
62
85
20
financeinvestmentcapitaldebtequity+1 more
Bootstrap 4.5.3jQuery 3.5.1FontAwesomeSlick Carousel
2025-07-22T22:28:45.299Z
nedbank.co.za favicon

Nedbank Ltd

nedbank.co.za

0
FinanceSouth AfricaenterpriseMEDIUM

Nedbank Ltd operates a comprehensive personal banking website offering a wide range of financial products and services including loans, credit cards, accounts, investments, and insurance. The site targets personal banking customers primarily in South Africa and positions itself as a trusted financial partner with competitive offerings and clear guidance. The website is professionally designed with consistent branding and clear navigation, reflecting the enterprise scale and market position of Nedbank as a major South African financial institution. Technically, the site is built on Adobe Experience Manager with modern JavaScript libraries and integrates multiple analytics and marketing tools such as Adobe Launch, Google Tag Manager, TikTok Pixel, and Facebook Pixel. The site is mobile optimized and SEO friendly, providing a good user experience. Security posture is strong with HTTPS enforced and no visible vulnerabilities, although security headers are not explicitly detected in the provided data. Privacy and cookie policies are present with consent mechanisms, and incident reporting contacts are clearly provided, demonstrating good compliance and transparency. WHOIS data is unavailable, which is common for .za domains but reduces domain registration transparency. Overall, the website is trustworthy and professionally maintained, supporting Nedbank's brand reputation.

85
53
2
80
95
85
100
bankingfinancepersonalloanscreditcardsinsurance+2 more
jQuery 3.7.1Adobe Launch (Adobe DTM)Google Tag ManagerGoogle Analytics+6

Partner Domains:

private.nedbank.co.za
sister
nedbank-private-wealth.nedbank.co.za
sister

+3 more partners

2025-07-22T16:50:28.442Z
venmo.com favicon

Venmo

venmo.com

0
FinanceUnited StateslargeMEDIUM

Venmo is a well-established mobile payment platform founded in 2008 and currently operating as a subsidiary of PayPal Holdings, Inc. It offers peer-to-peer payment services, enabling users to manage balances, send and receive money, and split bills seamlessly. The website reflects Venmo's strong market position as a leading social payments app in the United States, targeting consumers who prefer mobile and social payment solutions. The business model focuses on facilitating easy and social financial transactions among friends and networks. Technically, the website is built using modern frameworks such as React and Gatsby, hosted on AWS infrastructure, and integrates analytics tools like Google Analytics and mParticle for data-driven insights. The site is optimized for performance, mobile responsiveness, and accessibility, providing an excellent user experience. SEO practices are well implemented with comprehensive meta tags and structured data. From a security perspective, Venmo enforces HTTPS, employs multiple security headers, and uses domain registration protections to safeguard its digital presence. However, DNSSEC is not enabled, and there is no public security.txt or explicit incident response contact information, which are areas for improvement. Privacy compliance is strong with clear policies and consent mechanisms, aligning with GDPR requirements. Overall, Venmo's website demonstrates a high level of professionalism, security, and compliance, supporting its credibility and trustworthiness in the financial technology sector. Strategic recommendations include enabling DNSSEC, publishing vulnerability disclosure information, and enhancing incident response transparency to further strengthen security posture.

50
85
30
82
82
85
100
paymentsmobilepaymentssocialpaymentsfinancepeer-to-peer+1 more
ReactGatsbyGoogle AnalyticsmParticle+1

Partner Domains:

paypal.com
parent
2025-07-22T06:25:12.580Z
cashmatters.org favicon

Cash Matters

cashmatters.org

0
FinanceN/asmallMEDIUM

Cash Matters is a non-profit advocacy platform dedicated to supporting and promoting the use of cash within the global payment industry. The website serves as a hub for news, studies, events, and resources that emphasize the importance of cash as a payment method, highlighting its role in privacy, inclusion, and financial freedom. The organization targets consumers, industry stakeholders, and policymakers, positioning itself as a credible voice in the payments landscape. Technically, the website is built using modern web technologies including React and Next.js, with Apollo GraphQL for data management and Amazon Cloudfront for content delivery. The site is well-optimized for performance and mobile devices, featuring a professional design and clear navigation. Analytics are implemented via Google Analytics and Google Tag Manager, with appropriate privacy and cookie policies in place, indicating a good level of digital maturity. From a security perspective, the site enforces HTTPS and follows several best practices, though explicit security headers like Content-Security-Policy and X-Frame-Options are not visibly set. No vulnerabilities or exposed sensitive data were detected. The lack of WHOIS data due to privacy protection is typical for non-profit organizations and does not detract from the site's legitimacy. Overall, the security posture is solid but could be improved with additional headers and a vulnerability disclosure policy. The overall risk assessment is low, with the site demonstrating professionalism, compliance with privacy regulations, and a clear mission. Strategic recommendations include enhancing security headers, publishing a vulnerability disclosure policy, and providing clearer contact information to improve trust and transparency.

65
68
2
55
95
75
100
cashpaymentsadvocacyfinancenon-profit+3 more
ReactNext.jsApollo GraphQLCloudfront CDN+1
2025-07-22T00:47:56.476Z
siba.ch favicon

SIBA Swiss Insurance Brokers Association

siba.ch

0
FinanceSwitzerlandsmallHIGH

SIBA Swiss Insurance Brokers Association is a professional membership organization serving insurance brokers in Switzerland. The website provides information about the association, membership options, education, regulatory guidance, and contact details. The target audience is insurance brokers and related professionals within the Swiss finance sector. The business model is centered on membership services and professional development. The website is well-branded and consistent, with a professional design and clear navigation primarily in German with French language options. Technically, the site uses a modern JavaScript framework (Vue.js) and includes Typekit fonts for typography. The performance is moderate with good mobile optimization. However, SEO and accessibility features are basic, and no structured data or advanced metadata are present. The site is served over HTTPS but lacks visible security headers and cookie consent mechanisms. From a security perspective, the site has a basic security posture with HTTPS enabled but no advanced security headers or published security policies. No vulnerabilities or exposed sensitive data were detected in the provided content. Privacy compliance is partial, with a privacy policy present but no cookie consent or GDPR compliance indicators. Contact information is clearly provided, enhancing business credibility. Overall, the website is professional and trustworthy with room for improvement in security practices, privacy compliance, and technical SEO. Strategic recommendations include implementing security headers, adding cookie consent, publishing security and incident response policies, and enhancing accessibility and SEO.

15
53
2
70
72
75
-
insurancebrokersassociationswitzerlandfinance
JavaScriptVue.jsTypekit fonts
2025-07-22T00:46:25.446Z
worldcoinindex.com favicon

Cryptocoin price index and market cap - WorldCoinIndex

worldcoinindex.com

0
FinanceN/amediumMEDIUM

WorldCoinIndex is a cryptocurrency market data aggregator providing real-time price indexes, market capitalization, trading volumes, charts, and news for a wide range of cryptocurrencies. The platform targets cryptocurrency traders, investors, and enthusiasts seeking comprehensive market insights. It offers key services such as price tracking, market cap data, volume statistics, and API access for integration. The website demonstrates a professional design with consistent branding and good content quality, positioning itself as a reliable source in the crypto finance sector. Technically, the site employs modern web technologies including Bootstrap for responsive design, Google Fonts, FontAwesome icons, and integrates advertising and analytics services such as Amazon A9 Ads, Google Ad Manager, Google Analytics, and Google Tag Manager. The site is mobile optimized and shows moderate performance with good SEO practices. However, accessibility features are basic and could be improved. From a security perspective, the site enforces HTTPS and uses some best practices like lazy loading scripts and ads. However, it lacks explicit security headers such as Content-Security-Policy and X-Frame-Options, and does not provide a security policy, incident response contacts, or vulnerability disclosure information. Privacy compliance is weak, with no visible privacy or cookie policies and no GDPR compliance indicators. Overall, the website is functional and professional but would benefit from enhanced privacy and security transparency. The domain uses privacy protection for WHOIS data, which is common in the crypto industry but reduces trust slightly due to lack of registrant transparency. No WAF or blocking mechanisms were detected, allowing full content access for analysis.

40
65
17
55
75
85
100
cryptocurrencycryptomarketdatapriceindexbitcoin+3 more
Google FontsFontAwesomeGoogle Tag ManagerGoogle Analytics+4
2025-07-21T20:10:13.344Z
coinranking.com favicon

Coinranking B.V.

coinranking.com

0
FinanceNetherlandsmediumMEDIUM

Coinranking B.V. operates a comprehensive cryptocurrency market data platform providing real-time prices, rankings, and analytics for a wide range of cryptocurrencies. Established in 2017 and based in the Netherlands, the company targets crypto investors, traders, and enthusiasts by offering detailed market insights and API services. The platform is well-positioned in the crypto data market with a medium-sized operation and a consistent brand presence. Technically, the website leverages modern web technologies including the Astro framework, HTMX for dynamic content loading, and integrates with Google Tag Manager and AdButler for analytics and advertising. Hosting is managed via AWS DNS infrastructure, ensuring reliable performance and scalability. The site is fast, mobile-optimized, and accessible with good SEO practices. From a security perspective, the site enforces HTTPS and employs domain transfer protection, but lacks DNSSEC and explicit security headers. No dedicated security policy or incident response information is publicly available, and no vulnerability disclosure program is evident. Privacy compliance is strong with clear cookie consent mechanisms and comprehensive privacy and terms of service documentation. Overall, Coinranking demonstrates a mature digital presence with strong content quality and business credibility. Security posture is adequate but could be improved with additional headers and transparency. The site is safe for general audiences and does not contain adult or explicit content.

15
53
2
75
82
75
100
cryptocurrencycryptopricesmarketdatafinanceblockchain+2 more
JavaScriptHTMXAstro frameworkGoogle Tag Manager+2
2025-07-21T20:10:03.321Z
bezvasplatky.sk favicon

Home Credit Slovakia, a. s.

bezvasplatky.sk

0
FinanceSlovakiamediumHIGH

The website www.bezvasplatky.sk is an e-commerce platform operated by Home Credit Slovakia, a. s., specializing in the sale of consumer electronics and household products with installment payment options at zero interest. The platform targets Slovak consumers seeking flexible payment solutions for products such as mobile phones, notebooks, tablets, and home appliances. The business model integrates retail sales with financial services, positioning itself as a convenient and accessible online shopping destination in Slovakia. The website demonstrates consistent branding aligned with its parent company, Home Credit Group, and offers a broad product catalog structured for ease of navigation. From a technical perspective, the website leverages the Upgates e-commerce platform, integrates Google Tag Manager for analytics, and uses Google Fonts for typography. The site is mobile responsive and provides a moderate performance experience. However, some accessibility features could be enhanced to improve compliance and user experience. SEO practices are adequately implemented with proper meta tags and structured navigation. Security posture is solid with HTTPS enforced and cookie consent mechanisms in place, indicating GDPR awareness. Nonetheless, the absence of explicit privacy policies, terms of service, and security headers such as Content-Security-Policy and X-Frame-Options suggests room for improvement in security and compliance documentation. No vulnerabilities or exposed sensitive data were detected in the provided content. Overall, the website presents a trustworthy and professional online retail presence with moderate technical maturity and security practices. Strategic enhancements in privacy documentation, security headers, and contact transparency would further strengthen its compliance and user trust.

65
10
17
40
72
75
20
e-commerceelectronicsinstallmentpaymentsslovakiahomecredit
Google Tag ManagerGoogle FontsjQuery (implied by bootstrap classes)Bootstrap CSS framework (implied)+1

Partner Domains:

homecredit.sk
parent
2025-07-17T17:47:46.396Z
aro-treuhand.ch favicon

ARO Treuhand GmbH

aro-treuhand.ch

0
FinanceSwitzerlandsmallMEDIUM

ARO Treuhand GmbH is a Swiss fiduciary services company providing comprehensive accounting, tax, payroll, and business consulting services primarily to small and medium-sized enterprises across Switzerland. The company emphasizes a constructive and transparent partnership with clients, leveraging modern technologies and automated processes to deliver efficient and reliable solutions. Their market position is that of a trusted regional player with a focus on personalized service and professional expertise. Technically, the website is built on WordPress using the Themify Ultra theme and several professional plugins including Builder Slider Pro, Contact Form 7, and Complianz GDPR for cookie management. The site is well-optimized for mobile devices and includes modern security features such as HTTPS and Google reCAPTCHA v3 on forms. Performance is moderate with good SEO and accessibility basics in place. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism compliant with GDPR. However, it lacks some advanced security headers and a dedicated security policy or vulnerability disclosure page. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is consistent with the business claims, enhancing trustworthiness. Overall, the website presents a professional and trustworthy digital presence with good compliance and security posture. Strategic improvements could include adding security headers, publishing a security policy, and implementing a security.txt file to further enhance transparency and security readiness.

15
80
17
55
72
80
-
fiduciarytreuhandfinanceconsultingswitzerland+2 more
WordPress 5.9.3Themify Ultra ThemejQuery 3.6.0Builder Slider Pro plugin+3
2025-07-17T17:37:55.162Z
L

London Stock Exchange Group (LSEG)

fx.com

0
FinanceUnited KingdomenterpriseMEDIUM

The website represents FXall, a comprehensive electronic FX trading platform operated by the London Stock Exchange Group (LSEG). It offers a full suite of FX trading services including spot, forwards, swaps, NDFs, and options with access to a broad liquidity pool and post-trade processing capabilities. The platform targets institutional clients such as asset managers, hedge funds, corporates, and banks, positioning itself as a leading solution in the FX electronic trading market. The site is professionally designed, well-branded, and provides rich content and resources to support its users. Technically, the website leverages modern web technologies including jQuery, Adobe Experience Manager CMS, Adobe DTM for tag management, and Qualtrics for user feedback and analytics. The site is mobile optimized, accessible, and SEO friendly. Security posture is strong with HTTPS enforced, secure login mechanisms, and no visible vulnerabilities. Privacy and cookie policies are comprehensive and GDPR compliant, though direct contact emails and phone numbers are not publicly listed, relying instead on a secure contact form. Overall, the site demonstrates a mature digital infrastructure and a strong security posture appropriate for a financial services platform. The absence of WHOIS data is noted but likely due to privacy or registrar restrictions and does not detract from the site's legitimacy given the strong brand and trust indicators. The platform is well-positioned in the market with a clear business model and target audience. Strategic recommendations include enhancing visible security disclosures such as incident response contacts and vulnerability disclosure policies, and providing direct contact information to improve user trust and support accessibility.

70
68
17
80
100
65
100
fxtradingelectronictradingplatformfinancialserviceslsegcapitalmarkets+3 more
jQuery 3.4.1Adobe DTM (Dynamic Tag Manager)Qualtrics DXJSAEM (Adobe Experience Manager) CMS

Partner Domains:

www.londonstockexchange.com
partner
loginservice.fxall.com
service
2025-07-17T15:50:15.331Z
cite-gestion.com favicon

Cité Gestion

cite-gestion.com

0
FinanceSwitzerlandmediumMEDIUM

Cité Gestion is a Swiss private bank specializing in personalized wealth management solutions for both Swiss and international clients. The bank emphasizes a unique business model that combines the security and regulatory compliance of a FINMA-regulated institution with the flexibility and independence of an agile private bank. With 15 years of experience and CHF 9.5 billion in assets under management, Cité Gestion positions itself as a trusted partner offering bespoke investment solutions and a high-quality operational infrastructure. The website reflects a professional and well-branded digital presence, supporting multiple languages and featuring multimedia content to engage its audience. Technically, the website employs a modern JavaScript technology stack including jQuery, Google Analytics, Google Tag Manager, and reCAPTCHA v3 for security. The site is mobile-optimized with good SEO practices and a cookie consent mechanism that aligns with GDPR requirements. However, some security headers are not visibly implemented, and no explicit terms of service or incident response policies are published, which could be improved. From a security perspective, the site uses HTTPS with strong SSL configuration and integrates Google reCAPTCHA to protect forms. The absence of WHOIS registration data raises some concerns about domain registration transparency, although the website content and business information suggest legitimacy. Overall, the security posture is good but could benefit from enhanced header policies and published security frameworks. The overall risk assessment indicates a professional and trustworthy financial institution with minor gaps in transparency and security documentation. Strategic recommendations include verifying domain registration details, publishing comprehensive security and incident response policies, and implementing additional security headers to strengthen protection and trust.

30
83
17
80
72
85
20
wealthmanagementprivatebankfinanceswissbankinvestment+2 more
jQueryGoogle AnalyticsGoogle Tag ManagerreCAPTCHA v3+6
2025-07-17T13:31:21.083Z
usetreno.cz favicon

Ušetřeno.cz s.r.o.

usetreno.cz

0
FinanceCzech RepublicmediumMEDIUM

Ušetřeno.cz s.r.o. operates a well-established Czech online platform specializing in comparison and brokerage services across energy, finance, insurance, and telecommunications sectors. The company offers consumers tools to compare prices and services such as energy suppliers, loans, mortgages, insurance policies, and mobile tariffs, aiming to help users save money efficiently. As part of the ČSOB group, Ušetřeno.cz benefits from strong market positioning and credibility within the Czech Republic. The website features a professional design, clear navigation, and interactive calculators that enhance user engagement and experience. Technically, the website leverages modern web technologies including Vue.js for frontend interactivity, Google Tag Manager for analytics, and Cookiebot for cookie consent management, reflecting a mature digital infrastructure. The site is mobile-optimized and SEO-friendly, although some accessibility features could be improved. Security-wise, HTTPS is enforced, and cookie consent mechanisms are in place; however, the absence of explicit security headers and a security.txt file indicates room for enhancement in security posture and incident response readiness. The WHOIS data for the domain is unavailable, which raises concerns about transparency and domain registration legitimacy. Despite this, the website's content quality, business information, and affiliation with a reputable financial group mitigate some trust concerns. Overall, the platform demonstrates a solid business and technical foundation with moderate security maturity, suitable for its consumer-facing financial services role. Strategic recommendations include implementing comprehensive security headers, publishing a vulnerability disclosure policy, enhancing accessibility compliance, and improving transparency around domain registration and incident response contacts to strengthen trust and security culture.

50
40
17
85
75
85
100
energyfinanceinsurancetelecommunicationscomparison+2 more
Vue.jsGoogle Tag ManagerCookiebotFont Awesome

Partner Domains:

www.top-pojisteni.cz
partner
www.jobs.cz
partner
2025-07-17T11:10:18.900Z
U

UC AB

minuc.se

0
FinanceSwedenlargeMEDIUM

MinUC.se is a Swedish finance-focused website operated by UC AB, offering credit information and identity protection services to private individuals. The site provides multiple subscription and pay-per-use services such as Kreditkollen, Min Upplysning, Mitt Kreditbetyg, and ID-Skydd, positioning itself as a trusted resource for personal financial management and fraud prevention in Sweden. The website demonstrates a professional design with clear navigation and relevant content tailored to its target audience. Technically, the site uses modern JavaScript frameworks like Vue.js, integrates Google Tag Manager with consent mode, and employs a cookie consent mechanism, reflecting a mature digital infrastructure. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though the absence of explicit security headers suggests room for improvement. The WHOIS data for the domain is missing, which is inconsistent with the active website and lowers trust slightly, but the overall branding and content align with the reputable UC AB company. Privacy compliance is strong, with comprehensive policies and GDPR adherence. Overall, MinUC.se presents a reliable and professional online presence with minor technical and transparency improvements recommended.

50
83
17
40
67
65
100
financecreditinformationidprotectionswedenprivacy+2 more
JavaScriptVue.jsGoogle Tag ManagerSiteGainer+2

Partner Domains:

uc.se
partner
dibspayment.eu
partner
2025-07-17T11:09:13.771Z