Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 85 of 107|Showing 4201-4250 of 5311
Z

Zoomex

zoomex.com

0
FinanceN/amediumMEDIUM

Zoomex is a cryptocurrency trading platform offering both centralized and decentralized exchange services, including derivatives trading such as Inverse Perpetual and USDT Perpetual contracts. The platform targets global cryptocurrency traders and investors, boasting over 2 million registered users and a presence in more than 30 nations. It maintains a notable partnership with the MoneyGram Haas F1 Team, enhancing its brand credibility and market positioning. The business model revolves around providing a secure, reliable, and fast trading environment with additional services like express fiat-to-crypto purchases, copy trading, and affiliate programs. Technically, Zoomex employs modern web technologies including Vue.js and Element UI frameworks, supported by extensive analytics and tracking tools such as Google Analytics, Google Tag Manager, and various ad/tracking pixels. The platform is mobile-optimized with dedicated iOS and Android apps, ensuring accessibility and usability across devices. Performance is moderate with good SEO and basic accessibility features. From a security perspective, the site enforces HTTPS and claims robust asset protection via multi-signature cold/hot wallet systems. However, it lacks visible security headers and explicit incident response or vulnerability disclosure policies. Privacy compliance is partially addressed with a comprehensive privacy policy and terms of service, but no cookie consent mechanism is evident despite extensive tracking. Overall, Zoomex presents a professional and functional cryptocurrency trading platform with moderate trustworthiness. The absence of WHOIS registrant data and some security best practices slightly reduce confidence. Strategic improvements in security headers, privacy consent, and transparency around incident response would enhance its security posture and user trust.

15
58
17
85
95
85
100
cryptocurrencycryptoexchangebitcointradingderivativesfinance+1 more
JavaScriptVue.jsGoogle Tag ManagerGoogle Analytics+1

Partner Domains:

zoomex.finance
partner
affiliates.zoomex.com
partner

+1 more partners

2025-06-23T10:20:55.102Z
S

Svenska Försäkringsförmedlare

sfm.se

0
FinanceSwedenmediumHIGH

Svenska Försäkringsförmedlare (SFM) is a Swedish industry association dedicated to promoting high quality, fair competition, and strong self-regulation within the insurance mediation market. Established in 1995, SFM serves insurance intermediaries and related stakeholders by providing industry representation, compliance guidance, and member services including a mentor and trainee program. The website reflects a mature organization with clear branding and comprehensive content tailored to its target audience in Sweden's financial services sector. Technically, the site is built on WordPress, hosted by Loopia AB, and uses modern web technologies such as FontAwesome and JavaScript. The site is mobile-optimized and well-structured, though accessibility features are basic. Security posture is good with HTTPS enabled and no exposed sensitive data, but could be improved by enabling DNSSEC and adding security headers. Privacy compliance is partially addressed with a personal data handling PDF and cookie usage disclosure, but lacks an explicit cookie consent mechanism and detailed privacy policy pages. Contact information is clearly provided, enhancing business credibility. Overall, the site is professional, trustworthy, and functional with room for security and privacy enhancements.

15
25
2
70
52
65
20
insuranceindustryassociationswedenfinancialservicesinsurancemediation
WordPressFontAwesomeJavaScript

Partner Domains:

insurenet.se
partner
2025-06-23T10:20:25.009Z
evli.com favicon

Evli

evli.com

0
FinanceFinlandmediumMEDIUM

Evli is a Nordic asset management and investment firm serving private individuals, companies, and institutions. The company positions itself as a specialized wealth manager offering personalized services including Private Banking and a broad selection of investment funds. The website content is professionally presented in Finnish with multilingual support, targeting a Nordic audience. Evli's market position is that of a reputable regional financial services provider with a focus on wealth management and investment solutions. Technically, the website employs modern web technologies including Craft CMS, Google Tag Manager, Plausible Analytics, and Cookiebot for consent management. The site is well-optimized for mobile devices and demonstrates good SEO and accessibility practices. The presence of CSRF tokens and HTTPS indicates a solid security foundation, although explicit security headers are not evident in the provided data. Security posture is strong with enforced HTTPS, secure cookie usage, and a comprehensive cookie consent mechanism compliant with GDPR. However, the absence of a publicly accessible privacy policy or terms of service pages in the analyzed content is a gap. No WHOIS data is publicly available, likely due to privacy protection, which is common for financial institutions to safeguard sensitive registration details. Overall, the website presents a trustworthy and professional digital presence for Evli. The lack of WHOIS transparency slightly reduces trust but is mitigated by consistent branding and active social media engagement. Strategic recommendations include publishing explicit privacy and security policies, adding security headers, and providing vulnerability disclosure information to enhance transparency and compliance.

45
95
17
82
42
85
100
financeinvestmentprivatebankingnordicassetmanagement
Google Tag ManagerPlausible AnalyticsCookiebotList.js+1
2025-06-23T10:17:10.971Z
millistream.com favicon

Millistream AB

millistream.com

0
FinanceSwedenmediumMEDIUM

Millistream AB is a Sweden-based financial market data provider established in 2008, specializing in delivering real-time and historical market data, news, and corporate information from major global exchanges such as Nasdaq, NYSE, Deutsche Börse, and London Stock Exchange. The company targets financial institutions including banks, brokers, asset managers, and media companies, primarily in the Nordic region but with growing international reach. Their offerings include APIs, widgets, and a web-based trading application called Millistream Trader, designed to provide efficient and intuitive market views. Technically, the website is built on WordPress with the Enfold theme and leverages modern web technologies including jQuery, Google Analytics, and custom streaming APIs. The infrastructure supports low-latency data delivery via dedicated leased lines and cloud presence on AWS, indicating a mature and scalable technical setup. The site is mobile optimized and SEO friendly, though performance is moderate. From a security perspective, the site uses HTTPS and implements GDPR-compliant cookie consent mechanisms. However, it lacks publicly available privacy policies, terms of service, security policies, and incident response contacts, which are important for compliance and trust. No critical vulnerabilities or exposed sensitive data were detected, but security headers are not explicitly present, and no vulnerability disclosure policy is found. Overall, Millistream presents a professional and credible online presence with solid business and technical foundations. To enhance trust and compliance, it is recommended to publish comprehensive privacy and security policies, provide clear contact channels for security incidents, and implement additional security headers and disclosure mechanisms.

45
65
2
70
90
70
40
financialdatamarketdataapiwidgetstrader+2 more
WordPress 6.8.1Enfold Theme 4.5.7Yoast SEO pluginjQuery 3.7.1+4
2025-06-23T10:14:05.126Z
morningstar.se favicon

Morningstar, Inc.

morningstar.se

0
FinanceSwedenlargeMEDIUM

Morningstar Sverige is a localized Swedish website of Morningstar, Inc., a global financial services company specializing in investment research, fund data, and portfolio management tools. The website offers comprehensive financial content including fund prices, market news, and investment analysis targeted at both private investors and financial professionals in Sweden. The business model is primarily based on subscription services and advertising revenue, supported by a strong brand presence and consistent content quality. The site is well-established with a domain age dating back to 2000, reflecting a mature market position. Technically, the website employs a modern technology stack including jQuery, Bootstrap, New Relic monitoring, and OneTrust for cookie consent management. It integrates multiple third-party analytics and marketing tools such as Google Analytics, Google Tag Manager, and Qualtrics feedback modules. The site is hosted under a reputable registrar with DNS services from UltraDNS and NS1, though DNSSEC is not enabled. Performance is moderate with good mobile optimization and basic accessibility features. From a security perspective, the site enforces HTTPS and implements several security headers, though some headers like Content-Security-Policy could be more explicitly defined. The cookie consent mechanism is robust and GDPR compliant, providing users with granular control over cookie categories. No critical vulnerabilities or exposed sensitive data were detected. The domain registration data aligns well with the business claims, indicating a legitimate and trustworthy online presence. Overall, Morningstar Sverige demonstrates a strong security posture, good privacy compliance, and a professional digital presence. Recommendations include enabling DNSSEC, enhancing security headers, and maintaining regular audits of third-party scripts to mitigate potential risks. The site provides a reliable and user-friendly platform for investment research and financial data in the Swedish market.

85
83
2
85
72
70
100
financeinvestmentfundsstocksportfolio+3 more
jQuery 3.5.1Bootstrap 3.4.1New Relic monitoringOneTrust cookie consent+5
2025-06-23T09:09:54.437Z
fondo.se favicon

Fondo Solutions AB

fondo.se

0
FinanceSwedensmallMEDIUM

Fondo Solutions AB is a Swedish fintech company specializing in providing a cloud-native investment platform and API that enables financial and non-financial partners to integrate mutual fund investments seamlessly into their products and user journeys. The company positions itself as a market leader in Sweden with strategic partnerships such as Sharpfin, offering a modern, scalable, and compliant infrastructure for investment services. Their business model focuses on API-first solutions, digital onboarding, automated order execution, and regulatory compliance, targeting wealth managers, banks, fund companies, and other financial service providers. Technically, Fondo employs modern web technologies including htmx.org, Alpine.js, and Flowbite, hosted on Google Cloud infrastructure as indicated by DNS records. The website is well-optimized for performance, mobile responsiveness, and accessibility, reflecting a mature digital presence. SEO practices are solid with comprehensive meta tags and Open Graph data. From a security perspective, the site uses HTTPS and modern libraries without visible vulnerabilities. However, it lacks DNSSEC, security headers, and explicit security or incident response policies, which are areas for improvement. Privacy compliance is good with a clear privacy policy and terms of service, but the absence of a cookie consent mechanism is a notable gap. Overall, Fondo demonstrates a strong business credibility and technical maturity with a high trustworthiness level. Strategic recommendations include enhancing DNS security, implementing security headers, adding cookie consent, and publishing vulnerability disclosure information to further strengthen security posture and compliance.

15
28
2
75
52
80
100
investmentapimutualfundsfinancewealthmanagement+2 more
htmx.orgAlpine.jsFlowbiteLenis (smooth scrolling)+1

Partner Domains:

getdreams.com
partner
sharpfin.com
partner

+3 more partners

2025-06-23T09:09:34.323Z
invescoonline.ie favicon

Unio Financial Services Limited

invescoonline.ie

0
FinanceIrelandmediumCRITICAL

Unio Financial Services Limited, formerly known as Invesco Ltd, operates as a pension and investment consultancy firm based in Ireland. The company provides online pension administration services targeting scheme members, employers, trustees, and enrollers. The website serves as a portal for account management and information access, reflecting a medium-sized financial services business regulated by the Central Bank of Ireland. The site content is professionally presented with clear navigation and relevant business information. Technically, the website employs common web technologies such as jQuery, Bootstrap, and Parsley.js for client-side validation, indicating a moderate level of digital maturity. The presence of a cookie consent mechanism and privacy policy suggests attention to privacy compliance, although some areas like security headers and incident response policies are lacking. Overall, the security posture is adequate but could be improved with enhanced HTTP security headers and explicit security disclosures. The website is accessible without WAF or blocking mechanisms, supporting a positive user experience. Strategic recommendations include strengthening security headers, formalizing incident response and vulnerability disclosure policies, and enhancing accessibility and SEO.

-
-
-
-
-
-
-
financepensioninvestmentonlineportalfinancialservices
jQueryBootstrapParsley.jsFont Awesome+1

Partner Domains:

invescoeasysteps.ie
partner
2025-06-23T04:22:17.216Z
sainsburysbank.co.uk favicon

Sainsbury’s Bank

sainsburysbank.co.uk

0
FinanceUnited KingdomlargeCRITICAL

Sainsbury’s Bank operates as a UK-based financial services provider offering a broad range of consumer financial products including insurance, travel money, savings, loans, and credit cards. The website reflects a strong brand alignment with the Sainsbury’s retail group and recent operational changes involving the transfer of certain products to National Westminster Bank Plc. The company targets retail consumers seeking accessible and competitive financial products with a focus on ease of use and customer support. The business model leverages partnerships with established insurance underwriters and payment providers to deliver comprehensive financial services. Technically, the website employs modern web technologies including Google Tag Manager, Tealium, and Usabilla for analytics and user feedback, supported by a CMS likely Magnolia. The site is well-optimized for mobile and accessibility, with good SEO practices and clear navigation. Security posture is strong with HTTPS enforced and no visible vulnerabilities, though explicit security policy and incident response disclosures are absent. Privacy compliance is robust with clear cookie consent mechanisms and comprehensive privacy policies. Overall, the website demonstrates a mature digital presence consistent with a large financial institution, with good trust indicators and regulatory compliance.

-
-
-
-
-
-
-
financebankinginsurancetravelmoneypetinsurance+4 more
Google Tag ManagerTealium Tag ManagementUsabilla Feedback WidgetJavaScript+2

Partner Domains:

mypolicy.insurance-sainsburysbank.co.uk
partner
petinsurance.sainsburysbank.co.uk
partner

+3 more partners

2025-06-23T00:53:52.137Z
aviva.co.uk favicon

Aviva plc

aviva.co.uk

0
FinanceUnited KingdomenterpriseMEDIUM

Aviva plc is a leading UK-based insurance and financial services provider with a rich history spanning over 325 years. The company offers a broad portfolio of products including car, home, travel, life, and health insurance, as well as pensions, investments, and financial advice. Aviva holds a strong market position as the UK's largest insurance firm, serving over 20.5 million customers. Their website reflects a mature digital presence with comprehensive product information, customer support, and legal disclosures. Technically, the site leverages modern frameworks such as React and RequireJS, integrates Adobe Experience Manager for content management, and employs OneTrust for cookie consent management, indicating a high level of digital maturity and compliance focus. Security posture is robust with HTTPS enforced, cookie consent mechanisms, and no visible vulnerabilities or exposed sensitive data. However, explicit security headers could be further verified and a formal security policy or vulnerability disclosure page could enhance transparency. Overall, Aviva's website demonstrates professionalism, trustworthiness, and compliance with privacy regulations, supporting its enterprise-level stature in the financial sector.

65
88
17
85
77
70
100
insurancefinanceinvestmentretirementhealth+3 more
RequireJSAdobe DTM (Dynamic Tag Management)OneTrust Cookie ConsentReact (various React components)+7

Partner Domains:

www.direct.aviva.co.uk
subsidiary
connect.avivab2b.co.uk
subsidiary

+2 more partners

2025-06-22T22:35:57.425Z
stubbenedge.com favicon

Stubben Edge Group Limited

stubbenedge.com

0
FinanceUnited KingdommediumMEDIUM

Stubben Edge Group Limited operates a sophisticated financial services platform designed to streamline access to insurance, savings, and investment products for brokers, appointed representatives, independent financial advisors, and enterprises primarily in the UK. The platform integrates marketplace offerings, growth services, and APIs to enable users to build, scale, and grow their financial product businesses efficiently. The company positions itself as a scalable and integrated solution provider in the financial services sector, leveraging technology to simplify complex workflows and improve commission earnings. Technically, the website is built on the Webflow CMS platform, utilizing modern web technologies including Google Tag Manager, Google Analytics, Facebook Pixel, LinkedIn Insight Tag, and advanced JavaScript libraries like GSAP and SplitType.js for animations. The site is hosted likely on Webflow's infrastructure with Cloudflare CDN, ensuring fast performance and good mobile optimization. Accessibility is basic but functional, and SEO practices are well implemented with proper meta tags and Open Graph data. From a security perspective, the site enforces HTTPS and employs bot protection mechanisms such as Google reCAPTCHA and Cloudflare Turnstile on forms. However, it lacks explicit security headers and a published security policy or incident response contact, which are areas for improvement. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is partial; while a comprehensive privacy policy exists, there is no visible cookie consent mechanism, which may affect GDPR compliance. Overall, Stubben Edge presents a credible and professional online presence with strong business legitimacy and a solid technical foundation. The main risks relate to privacy compliance and security policy transparency. Strategic recommendations include implementing cookie consent, adding security headers, publishing a security policy, and enhancing incident response readiness to strengthen trust and compliance.

30
53
25
70
69
80
100
financeinsurancefinancialservicesplatformmarketplace+3 more
Google Tag ManagerGoogle AnalyticsFacebook PixelLinkedIn Insight Tag+5
2025-06-22T19:41:10.877Z
optimx.com favicon

OptimX Markets, Inc.

optimx.com

0
FinanceUnited StatessmallMEDIUM

OptimX Markets, Inc. operates a technology platform focused on institutional block trading, aiming to enhance transparency and simplify liquidity sourcing for large suppliers and consumers. The company positions itself as an innovator in the finance technology sector, targeting institutional traders with solutions that align incentives and foster relationship-based trading dynamics. The website content reflects a professional and consistent brand image, emphasizing their key services and market approach. Technically, the website is built on WordPress using the Enfold theme and Jetpack plugin, incorporating modern web technologies such as jQuery and MediaElement.js. The site includes embedded Vimeo video content and Google Fonts, and it is served over HTTPS with a valid SSL certificate. Performance and mobile optimization are moderate to good, though accessibility features are basic. SEO practices are adequately implemented with proper meta tags and Open Graph data. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and does not provide a published security policy or incident response information. No vulnerability disclosure or security.txt file is present. Privacy compliance is partial, with a privacy policy found under regulatory disclosures but no cookie consent mechanism or terms of service page. Contact information is limited to an email address with no phone or physical address provided. Overall, the website demonstrates a solid business credibility and technical foundation but would benefit from enhanced privacy compliance and security transparency. Strategic recommendations include implementing cookie consent, publishing security and incident response policies, adding vulnerability disclosure mechanisms, and improving accessibility to strengthen trust and compliance.

30
50
25
70
49
85
100
financeinstitutionaltradingtechnologyliquidityblocktrading
WordPressjQueryMediaElement.jsVimeo embedded video+1
2025-06-22T18:40:32.617Z
fundonion.com favicon

FundOnion

fundonion.com

0
FinanceUnited KingdomsmallCRITICAL

FundOnion is a UK-based business finance platform that connects small businesses directly with lenders, enabling users to find and compare business funding options quickly and transparently. The platform leverages a proprietary decision engine to filter eligible lenders and display their rates and terms, supporting various finance types including business loans, invoice financing, and asset financing. Positioned as a leading player in the UK SME finance market, FundOnion emphasizes user empowerment, transparency, and education through guides and resources. The website features strong branding, partner endorsements, and customer testimonials, reinforcing its credibility and market presence. Technically, FundOnion is built on the Webflow CMS platform, utilizing modern web technologies and integrating multiple analytics and marketing tools such as Google Analytics, Facebook Pixel, Hotjar, and Microsoft Clarity. The site is well-optimized for performance and mobile responsiveness, with good SEO and accessibility practices. Security is robust with HTTPS enforced and no visible vulnerabilities, although explicit security headers and policies could be enhanced. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. Overall, FundOnion demonstrates a mature digital infrastructure and a strong security posture appropriate for its business domain. The absence of a formal security policy or incident response contact is a minor gap. The domain registration data aligns with the business claims, supporting legitimacy. The platform's extensive use of tracking and marketing tools indicates a comprehensive approach to user engagement and business growth. Strategically, FundOnion should focus on formalizing its security policies, enhancing transparency around incident response, and continuing to strengthen trust signals to maintain and grow its market position in the competitive UK business finance sector.

-
-
-
5
5
5
5
businessloansfinancesmallbusinessukloancomparison+2 more
Webflow CMSGoogle Tag ManagerGoogle AnalyticsFacebook Pixel+8

Partner Domains:

british-business-bank.co.uk
partner
iwoca.co.uk
partner

+2 more partners

2025-06-22T14:20:16.500Z
K

Keary Financial

kearyfinancial.com

0
FinanceIrelandsmallHIGH

Keary Financial is a small Irish financial advisory firm led by Robert Keary, who holds multiple professional qualifications including QFA, RPA, and PTP. The company specializes in providing expert advice on pensions, investments, life cover, protection, and the Auto Enrolment Retirement Savings System. Positioned as a trusted financial broker in the Irish market, Keary Financial offers clients access to a broad range of products from leading life insurance companies. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to individuals and employers seeking financial planning services in Ireland. Technically, the website is built on WordPress using the Customizr Pro theme and several plugins including Yoast SEO and CoBlocks. It employs modern web technologies such as jQuery and Google Tag Manager for analytics and marketing. The site is mobile optimized and demonstrates good SEO practices, although accessibility features are basic. Performance is moderate with asynchronous loading of scripts. From a security perspective, the site enforces HTTPS and does not expose sensitive data. However, it lacks explicit security headers and does not provide a dedicated security policy or incident response contacts. Cookie consent is implemented, supporting basic privacy compliance. No critical vulnerabilities or suspicious elements were detected. Overall, the security posture is solid but could be improved with additional headers and transparency. The domain registration appears consistent with the business claims, supporting legitimacy. Contact information including a company email and phone number is clearly presented, along with a Facebook social media link. The website is suitable for its target audience and maintains a trustworthy online presence. Strategic recommendations include enhancing security headers, publishing a security policy, and providing incident response contacts to further strengthen trust and compliance.

15
53
10
70
67
70
20
financefinancialadvisorypensionsinvestmentsautoenrolment+2 more
WordPressjQueryYoast SEOGoogle Tag Manager+3
2025-06-22T10:37:59.138Z
rapidratings.com favicon

Rapid Ratings International, Inc.

rapidratings.com

0
FinanceUnited StatesenterpriseMEDIUM

Rapid Ratings International, Inc. is a leading enterprise focused on financial health intelligence and risk management solutions. Their platform empowers businesses worldwide to mitigate risks, strengthen relationships, and drive growth by providing comprehensive financial ratings and supply chain risk analytics. The company serves large enterprises and supply chain managers with services including supply chain risk analysis, third-party risk management, credit risk assessment, and professional workshops. Their market position is strong, supported by trusted certifications and a robust client base. Technically, the website is built on the Webflow platform, leveraging modern analytics and marketing technologies such as Google Tag Manager, Heap Analytics, and multiple tracking pixels. The site is well-optimized for performance, mobile responsiveness, and SEO, reflecting a mature digital infrastructure. Hosting is likely via Amazon CloudFront CDN, ensuring fast content delivery. From a security perspective, RapidRatings demonstrates a solid posture with HTTPS enforcement, presence of key security headers, and visible certifications including ISO 27001 and SOC Type II. Cookie consent mechanisms comply with GDPR standards, and no critical vulnerabilities or exposed sensitive data were detected. However, incident response contact details and vulnerability disclosure policies are not explicitly provided. Overall, the website and business present a low risk profile with high professionalism and trustworthiness. Strategic recommendations include publishing explicit incident response contacts, adding a vulnerability disclosure policy, and enhancing accessibility features to further strengthen compliance and security culture.

30
45
35
75
-
75
100
financeriskmanagementsupplychaincreditriskenterprise+2 more
Google Tag ManagerHeap AnalyticsFacebook PixelLinkedIn Insight Tag+4

Partner Domains:

accounts.rapidratings.com
service
help.rapidratings.com
service

+1 more partners

2025-06-22T09:00:07.654Z
cantorfitzgerald.ie favicon

Cantor Fitzgerald Ireland

cantorfitzgerald.ie

0
FinanceIrelandlargeMEDIUM

Cantor Fitzgerald Ireland is a well-established financial services firm specializing in wealth management, asset management, and corporate finance. With over 30 years of client trust and managing assets exceeding €8 billion, the company holds a strong market position in Ireland's finance sector. Their services cater to a diverse audience including individual investors, financial advisors, institutions, charities, and intermediaries. The website reflects a professional and consistent brand image, supported by regulatory compliance and industry recognition such as the Equity Manager of the Year award in 2024. Technically, the website is built on WordPress with modern technologies including jQuery, Slick Carousel, and Yoast SEO for optimization. It is hosted likely on WP Engine, ensuring good performance and mobile responsiveness. Accessibility and SEO practices are well implemented, contributing to a positive user experience. From a security perspective, the site uses HTTPS with no visible exposed sensitive data or vulnerable libraries. Cookie consent mechanisms are in place, and privacy policies are comprehensive and GDPR compliant. However, formal security policies and incident response contacts are not published, representing an area for improvement. Overall, the website demonstrates a high level of professionalism, trustworthiness, and compliance, with minor recommendations to enhance security transparency and header configurations. The domain WHOIS data aligns well with the business claims, reinforcing legitimacy and trust.

15
43
-
88
-
80
100
financewealthmanagementassetmanagementcorporatefinanceinvestment+1 more
jQuerySlick CarouselGoogle FontsYoast SEO+1

Partner Domains:

cantorportal.com
partner
2025-06-22T09:00:06.714Z
edfp.ie favicon

DFP Pension & Investment Consultants

edfp.ie

0
FinanceIrelandmediumMEDIUM

DFP Pension & Investment Consultants is a reputable financial advisory firm operating primarily in Ireland, offering tailored financial management advice to individuals, charities, corporate partnerships, and businesses. The company manages client funds exceeding €850 million and provides services including pensions, investments, financial planning, and protection. Their market position is strong within the Irish financial advisory sector, supported by clear regulatory compliance and multiple office locations. Technically, the website is built on the Squarespace platform, leveraging modern web technologies and integrations such as Google Tag Manager and Vimeo for video content. The site demonstrates good mobile optimization and moderate performance, with a professional design and clear navigation structure. SEO and accessibility are basic but adequate for the business domain. From a security perspective, the site enforces HTTPS and includes a cookie consent mechanism aligned with GDPR requirements. However, some security best practices such as enabling HSTS and publishing a formal security or incident response policy are absent. No vulnerabilities or exposed sensitive data were detected, indicating a generally sound security posture. Overall, the website presents a trustworthy and professional image with solid business credibility. Strategic recommendations include enhancing security headers, formalizing security policies, and improving accessibility to further strengthen the site's security and compliance posture.

35
70
-
80
-
85
100
financefinancialadvisorypensionsinvestmentsfinancialplanning+3 more
SquarespaceGoogle Tag ManagerGoogle AnalyticsVimeo embed
2025-06-22T09:00:06.615Z
knowyourcustomer.com favicon

Know Your Customer Limited

knowyourcustomer.com

0
FinanceUnited KingdommediumMEDIUM

Know Your Customer Limited is a UK-based award-winning RegTech company providing a SaaS ecosystem and APIs focused on business KYC verification, compliance, and corporate onboarding. Their platform serves financial institutions and regulated businesses globally, offering modular solutions such as KYC Workspace, KYC Data API, and KYC Review. The company is well-positioned in the market with strong industry partnerships and multiple prestigious awards, reflecting a high level of trust and recognition. Technically, the website is built on WordPress with modern plugins and tracking tools including Google Analytics, LinkedIn Insight, Hotjar, and Apollo.io. The site is hosted likely on WP Engine, optimized for mobile, and demonstrates good SEO and accessibility practices. Security posture is solid with HTTPS enforced and anti-spam measures in place, though some security headers could be improved and formal security policies published. Overall, the security posture is good with no critical vulnerabilities detected. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The business credibility is high, supported by client testimonials, certifications, and transparent company information. The domain registration details align well with the website content, indicating legitimacy. Strategic recommendations include enhancing security headers, publishing incident response contacts, adding vulnerability disclosure policies, and continuous monitoring of third-party scripts to maintain security and compliance.

15
63
5
70
-
80
100
kyccomplianceregtechamlbusinessverification+2 more
WordPressWPBakery Page BuilderYoast SEOGoogle Analytics+8

Partner Domains:

lexisnexis.com
partner
microsoft.com
partner

+3 more partners

2025-06-22T09:00:06.261Z
mellon.com favicon

Mellon Investments Corporation

mellon.com

0
FinanceUnited StateslargeMEDIUM

Mellon Investments Corporation is a well-established investment management firm specializing in index management and cash management strategies. As a subsidiary of The Bank of New York Mellon Corporation, it holds a strong market position as a global leader dedicated to precision and client partnership. The website reflects a professional and comprehensive digital presence, targeting institutional investors and financial professionals with detailed insights, strategies, and media content. The business model focuses on delivering customized investment solutions at scale, including direct indexing and fixed income strategies. Technically, the website is built on Adobe Experience Manager, leveraging modern JavaScript libraries and frameworks such as jQuery and Owl Carousel. It incorporates advanced accessibility features via the UserWay widget and employs a robust consent management platform (OneTrust) to ensure privacy compliance. The site demonstrates good SEO practices and mobile optimization, providing a smooth user experience. From a security perspective, while HTTPS usage is implied, explicit security headers are limited in the provided content. The site uses external scripts for analytics and marketing, including Adobe Analytics and Facebook Pixel, with consent mechanisms in place. No critical vulnerabilities or exposed sensitive data were detected. However, recommendations include enhancing HTTP security headers and publishing explicit security policies. Overall, Mellon Investments Corporation's website presents a high level of professionalism, trustworthiness, and compliance, with a strong business credibility score. The domain registration details align well with the company's identity, supporting legitimacy. Strategic recommendations focus on strengthening security posture and transparency to maintain and enhance trust in the digital environment.

70
58
5
70
-
85
100
investmentindexmanagementfinanceassetmanagementbnymellon+2 more
JavaScriptjQueryAdobe Experience Manager (AEM)Adobe Launch (Tag Manager)+4

Partner Domains:

pershing.com
partner
2025-06-22T09:00:05.998Z
ssga.com favicon

State Street Global Advisors Europe Limited

ssga.com

0
FinanceFinlandenterpriseMEDIUM

State Street Global Advisors Europe Limited operates as the asset management arm of State Street Corporation, providing a broad range of index and active investment strategies to institutional investors, financial professionals, and individual investors globally. The website reflects a mature, enterprise-level digital presence with a focus on compliance, user experience, and brand consistency. The company is positioned as a leading global asset manager with a strong regulatory framework and transparent marketing communications. Technically, the website leverages Adobe Experience Manager as its CMS, integrates advanced analytics and marketing tools such as Adobe Launch, OneTrust for cookie consent, and 6sense for marketing intelligence. The use of Akamai service workers and Helix RUM indicates attention to performance and user monitoring. The site is mobile-optimized and accessible, with good SEO practices. From a security perspective, the site uses HTTPS with strong SSL configuration, employs cookie consent mechanisms compliant with GDPR, and shows no signs of exposed sensitive data or vulnerabilities. However, explicit security headers are not clearly visible in the HTML and should be confirmed. Incident response and vulnerability disclosure information are not present on the site. Overall, the website demonstrates a high level of professionalism, compliance, and technical maturity, supporting the company's credibility and trustworthiness in the financial services sector.

55
63
-
70
-
85
100
assetmanagementfinanceinvestmentetfsspdr+5 more
JavaScriptAdobe Launch (Adobe DTM)OneTrust Cookie ConsentAkamai Service Worker+2
2025-06-22T09:00:05.972Z
C

The ultimate web site for Credit card comparison

creditcard.ie

0
FinanceN/asmallHIGH

The website creditcard.ie is a small-scale credit card comparison platform primarily serving consumers seeking to compare credit card options. The site operates as a lead generation tool, inviting users to register interest via a single email contact. The business model appears to rely on advertising revenue, as evidenced by the integration of Google AdSense ads. The website content is minimal and basic, lacking comprehensive business or legal information, and does not provide privacy or cookie policies. Technically, the site uses basic web technologies including Google Fonts and Google AdSense scripts. There is no evidence of a content management system or advanced frameworks. The site is served over HTTP without HTTPS, which is a significant security concern. Performance and mobile optimization are basic, with limited accessibility and SEO features. From a security perspective, the absence of HTTPS, security headers, and secure forms indicates a low security posture. There are no visible privacy compliance measures such as GDPR notices or cookie consent mechanisms. The site lacks incident response contacts or security policies. The domain registration is privacy protected, which reduces transparency and trustworthiness. Overall, the website presents moderate business credibility but poor security and privacy compliance. Strategic improvements in security infrastructure, privacy policies, and content quality are recommended to enhance trust and compliance.

15
-
-
60
-
80
20
creditcardcomparisonfinanceadvertising
Google FontsGoogle AdSenseJavaScript
2025-06-22T09:00:05.929Z
rimes.com favicon

Rimes Technology Corporation

rimes.com

0
FinanceUnited StateslargeHIGH

Rimes Technology Corporation is a well-established provider of investment data management solutions, serving asset managers, owners, and servicers globally. The company offers a comprehensive suite of services including enterprise data management, benchmarking, index solutions, data warehousing, and investment management platforms. Their market position is strong, supported by over 25 years of industry experience and a client base that includes leading financial institutions. The website reflects a professional and consistent brand image with rich content tailored to its target audience. Technically, the website is built on WordPress with modern JavaScript libraries and marketing tools such as Google Tag Manager and Pardot. The site demonstrates good mobile optimization and SEO practices, although accessibility features are basic. Performance is moderate, with room for improvement in loading speed and technical enhancements. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and published security or incident response policies, which are recommended for enhanced trust and compliance. Privacy policies are comprehensive and GDPR compliant, but the absence of a cookie consent mechanism is a gap in privacy compliance. Overall, the website presents a low-risk profile with strong business credibility and technical maturity. Strategic improvements in security headers, incident response transparency, and privacy consent mechanisms would further strengthen its posture.

15
43
5
60
-
80
100
investmentdatamanagementfinanceenterprisedatasolutionsassetmanagementbenchmarking+5 more
WordPressYoast SEOGoogle Tag ManagerjQuery+5

Partner Domains:

info.rimes.com
partner
2025-06-22T09:00:05.707Z
kta.ie favicon

KTA Tax Limited

kta.ie

0
FinanceIrelandmediumHIGH

KTA Tax Limited is an established Irish tax advisory firm specializing in private client tax advice and planning services. Founded in 1997, the company operates with a medium-sized team offering a broad range of tax-related services including income tax planning, estate planning, pension tax planning, and expatriate tax services. The firm targets private clients and their families, positioning itself as a trusted advisor in the Irish finance sector. The website reflects a professional business with clear service offerings and client engagement through a secure login portal. Technically, the website is built on ASP.NET WebForms with a CMS by Webtrade Ltd. It uses modern JavaScript libraries such as jQuery and integrates Google Analytics and reCAPTCHA for analytics and security. Cookie consent is managed via CookiePro, indicating awareness of GDPR compliance. However, some legacy technical elements like the IE7 compatibility header suggest areas for modernization. The site is moderately optimized for performance and mobile use, with basic accessibility and SEO features. From a security perspective, the site enforces HTTPS and includes standard security practices such as cookie consent and CAPTCHA. The absence of advanced security headers like Content-Security-Policy and the use of outdated browser compatibility headers are noted vulnerabilities. No critical security issues or WAF blocks were detected, and the domain registration details align well with the business claims, supporting legitimacy. Overall, KTA Tax Limited's website presents a credible, professional tax advisory service with moderate technical sophistication and a good security baseline. Improvements in privacy policy visibility and modern security headers would enhance compliance and security posture.

25
15
-
70
-
75
40
taxadvicefinancetaxplanningprivateclientsireland
jQuery 3.7.1Google AnalyticsGoogle reCAPTCHACookiePro Consent Management+1
2025-06-22T09:00:05.667Z
bcu.ie favicon

Ballincollig Credit Union Ltd.

bcu.ie

0
FinanceIrelandsmallHIGH

Ballincollig Credit Union Ltd. is a well-established, locally focused financial cooperative serving the Ballincollig community in County Cork, Ireland. The organization operates on a not-for-profit basis, offering key financial services such as loans, savings accounts, mortgages, and insurance products. The website reflects a strong market position as a trusted credit union regulated by the Central Bank of Ireland, targeting local community members seeking favorable financial products and services. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, Google Analytics, and GDPR-compliant cookie consent mechanisms. The site demonstrates good digital maturity with responsive design, SEO optimization, and integration of online banking and loan calculator tools, enhancing user engagement and service accessibility. From a security perspective, the site enforces HTTPS, anonymizes IPs in analytics, and employs cookie consent with granular controls. No critical vulnerabilities or exposed sensitive data were detected. However, security headers could be improved, and incident response contact information is not explicitly provided. Privacy compliance is strong with comprehensive policies and GDPR adherence. Overall, the website presents a professional, trustworthy, and user-friendly digital presence for Ballincollig Credit Union. Strategic recommendations include enhancing security headers, publishing incident response contacts, and improving accessibility features to further strengthen security posture and compliance.

40
70
35
60
-
80
20
creditunionfinanceloanssavingsmortgages+3 more
WordPressYoast SEO pluginjQueryFont Awesome+3
2025-06-22T09:00:05.663Z