Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 68 of 127|Showing 3351-3400 of 6333
V

Vilks un briedis

vilksunbriedis.lv

0
HospitalityLatviasmallHIGH

Vilks un briedis is a small hospitality business based in Latvia offering guesthouse accommodation and wellness services including sauna, outdoor pool, and rental services such as bicycles and cars. The website presents a professional and consistent brand image targeting general audiences interested in healthful relaxation and local hospitality experiences. The business operates primarily in the hospitality sector with a local market focus in Smiltene, Latvia. Technically, the website uses older JavaScript libraries such as jQuery 1.4.2 and jCarousel for gallery functionality, along with Google Analytics for visitor tracking. The site lacks modern CMS indicators and does not show evidence of advanced frameworks or hosting details. Performance and mobile optimization are basic, with room for improvement in accessibility and SEO. From a security perspective, the site does not display security headers or privacy and cookie policies, indicating compliance gaps with GDPR and modern data protection standards. The use of outdated JavaScript libraries may expose the site to vulnerabilities. No WHOIS data was available due to query limits, limiting domain legitimacy verification. No WAF or blocking mechanisms were detected, and the site content is safe and appropriate for general audiences. Overall, the website is functional and professionally presented but requires improvements in security posture, privacy compliance, and technical modernization to enhance trust and protect user data effectively.

20
10
2
70
52
75
20
hospitalitywellnessguesthousesaunasmiltene+1 more
jQuery 1.4.2jCarouselGoogle Analytics
2025-07-30T16:00:30.480Z
iecupes.lv favicon

"Iecupes" – Viesu nams Iecavas upes ielokā

iecupes.lv

0
HospitalityLatviasmallHIGH

The website "Iecupes" represents a small hospitality business located in Latvia, offering accommodation, event hosting, and recreational services such as sauna and cottages by the river. The business targets couples, event organizers, and tourists seeking a scenic and well-equipped venue for weddings, seminars, and leisure. The site content is professionally presented with customer testimonials and active social media engagement, indicating a positive market presence. Technically, the website is built on WordPress using the Elementor page builder and OceanWP theme, integrating Google Analytics and AdSense for tracking and monetization. The site is mobile-optimized and loads with moderate performance. However, it lacks advanced security headers and privacy policies, which are important for compliance and user trust. Security posture is adequate with HTTPS enabled and no visible vulnerabilities or exposed sensitive data. The absence of privacy and cookie policies, as well as security headers, reduces the overall security and compliance score. No WHOIS data was available due to query limits, but the website content and structure suggest a legitimate and small-scale hospitality business. Overall, the website is functional and trustworthy for its business purpose but would benefit from enhanced privacy compliance and security hardening to improve user trust and regulatory adherence.

15
10
2
70
70
85
20
hospitalityeventhostingaccommodationlatviawordpress+1 more
WordPress 6.2.6Elementor 3.16.6OceanWP themejQuery 3.6.4+2
2025-07-30T16:00:30.281Z
albatrosshome.lv favicon

SIA Albatross Spa

albatrosshome.lv

0
HospitalityLatviasmallMEDIUM

Albatross Resort, operated by SIA Albatross Spa, is a hospitality business located in Latvia offering seaside resort accommodations combined with wellness and recreational services such as spa treatments, fitness facilities, swimming lessons, and nutrition consultations. The website targets tourists and visitors seeking a modern, comfortable, and nature-integrated vacation experience. The business positions itself as a regional resort with a focus on quality service and natural surroundings. Technically, the website is built on WordPress using popular plugins like WooCommerce for e-commerce, Elementor for page building, and specialized booking plugins such as Motopress Hotel Booking and Amelia Booking. The site employs modern web technologies including jQuery and integrates Facebook Pixel for marketing and analytics. Performance optimizations are implemented via WP Rocket, and SEO is managed with Rank Math, indicating a mature digital infrastructure. From a security perspective, the site uses HTTPS with good SSL configuration and implements standard security headers. Privacy and cookie policies are present with consent mechanisms, supporting GDPR compliance. However, there is no publicly available security policy or incident response information, and no vulnerability disclosure program is evident. No critical vulnerabilities or exposed sensitive data were detected in the analysis. Overall, the website presents a professional and trustworthy front for the resort business, with good content quality and technical implementation. The lack of WHOIS data limits full domain trust assessment, but the site’s content and structure support legitimacy. Strategic recommendations include publishing a security policy, adding incident response contacts, and considering a vulnerability disclosure channel to enhance security posture and trust.

25
25
2
60
75
80
100
hospitalityresortspabookingwellness+3 more
WordPressWooCommerceElementorMotopress Hotel Booking plugin+5
2025-07-30T16:00:28.146Z
keepmybag.lv favicon

Keep my bag

keepmybag.lv

0
HospitalityLatviasmallHIGH

Keep My Bag operates an automated luggage storage service located in the heart of Riga's Old City Center, targeting travelers and tourists seeking secure and convenient luggage storage solutions. The website presents a professional and user-friendly interface with clear descriptions of services, pricing, and contact information. The business model revolves around renting automated lockers with PIN access, providing a hands-free experience for customers exploring Riga. Technically, the website is built on WordPress and integrates Google Analytics, Google Tag Manager, and Google Maps API for tracking and location services. The site is mobile-optimized with responsive design and uses modern web fonts. However, there is no evidence of advanced security headers or explicit privacy and cookie policies, which are important for compliance and user trust. From a security perspective, the site uses HTTPS (implied by URLs), but lacks visible security headers and formal privacy or incident response policies. No forms collecting sensitive data were found, reducing immediate risk exposure. The absence of WHOIS data limits domain legitimacy verification, but the website content and contact details appear consistent with a legitimate small business. Overall, the website scores moderately well in content quality, business credibility, and technical implementation but falls short in privacy compliance and security best practices. Strategic improvements in privacy policy publication, security headers implementation, and WHOIS transparency would enhance trust and compliance.

15
10
2
70
72
75
-
luggagestoragerigaautomaticlockertravelservicesecurestorage
Google AnalyticsGoogle Tag ManagerGoogle Maps APIMontserrat font from Google Fonts
2025-07-30T16:00:26.148Z
travelventspils.lv favicon

Brīvdienu māja PODNIEKI

travelventspils.lv

0
HospitalityLatviasmallMEDIUM

The website travelventspils.lv represents a small family-friendly guest house named Brīvdienu māja PODNIEKI located in Ventspils, Latvia. The business focuses on hospitality services catering primarily to families with children and tourists visiting the region. The site provides accommodation booking information primarily via phone and WhatsApp, with additional tourist information links to the official Ventspils tourism site. The market position is local and niche, targeting visitors seeking a family-oriented stay in Ventspils. Technically, the website is built on the Mozello CMS platform and leverages Amazon CloudFront CDN for content delivery. It uses legacy JavaScript libraries such as jQuery 2.2.4 and plugins like Fancybox3 for UI components. The site is moderately optimized for mobile devices and has basic SEO and accessibility features. However, there is no evidence of advanced frameworks or modern JavaScript technologies. From a security perspective, the site lacks visible security headers and privacy or cookie policies, which are critical for GDPR compliance given its European location. No WHOIS data was retrievable due to query limits, limiting domain legitimacy verification. The site uses HTTPS (implied by canonical URL) but lacks explicit security best practices such as CSP or HSTS headers. Contact information is limited to phone numbers without email or contact forms, reducing attack surface but also limiting user engagement options. Overall, the website is functional and appropriate for its business purpose but shows gaps in privacy compliance and security hardening. The absence of WHOIS data and privacy policies reduces trustworthiness from a compliance standpoint. Strategic improvements in security headers, privacy documentation, and WHOIS transparency would enhance the site's credibility and compliance posture.

20
10
2
60
75
75
100
hospitalityguesthousefamilyfriendlyventspilslatvia+2 more
jQuery 2.2.4Fancybox3BannerplayResponsiveVideos+1
2025-07-30T16:00:25.993Z
hotelstelles.lv favicon

SIA GIK

hotelstelles.lv

0
HospitalityLatviasmallMEDIUM

Hotel Stelles, operated by SIA GIK, is a small hospitality business located in Tukums, Latvia, specializing in group accommodation and event space rental for up to 50 people. The website offers detailed information about their rooms, event halls, and catering options, targeting groups and business clients seeking comfortable lodging and venues for seminars, banquets, and social gatherings. The business maintains a local market position with clear contact channels and social media presence, enhancing customer engagement and trust. Technically, the website is built on the MultiScreenSite platform, utilizing modern web technologies including jQuery, Google Analytics, Google Tag Manager, and service workers for PWA capabilities. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features are basic, and security headers are not explicitly detected, though HTTPS is properly enforced. From a security perspective, the site employs Google reCAPTCHA on its reservation form to mitigate spam and abuse. No critical vulnerabilities or exposed sensitive data were found. Privacy compliance is partial; a privacy policy is present but lacks a cookie consent mechanism, which is recommended for GDPR adherence. WHOIS data could not be retrieved due to query limits, limiting domain registration verification. Overall, Hotel Stelles presents a professional and trustworthy online presence suitable for its hospitality niche. Strategic improvements in privacy compliance and security headers would enhance its security posture and regulatory adherence.

100
60
75
72
17
10
70
hospitalityhoteleventspacegroupaccommodationlatvia+4 more
jQuery 3.7.0Google Analytics (gtag.js)Google Tag ManagerPhotoswipe+3
2025-07-30T16:00:25.972Z
J

Jēkabpils Rezidence

jekabpilsrezidence.lv

0
HospitalityLatviasmallHIGH

Jēkabpils Rezidence is a regional business and tourism development association focused on promoting tourism, historical sites, culture, and accommodation in Jēkabpils, Latvia. The website serves as an informational portal highlighting local attractions, nature tourism, and active recreation opportunities. It targets tourists and visitors interested in exploring the region's heritage and natural beauty. The business model centers on regional promotion rather than direct commercial sales. Technically, the website is built on WordPress with common plugins such as Yoast SEO and uses jQuery and Bootstrap for frontend functionality. The site is served over HTTPS with a valid SSL certificate, indicating a secure connection. The design is responsive and user-friendly, with good SEO optimization and basic accessibility features. However, there is room for improvement in security headers and privacy compliance. From a security perspective, the site lacks explicit security policies, privacy and cookie policies, and incident response information. No contact emails or phone numbers are provided, which limits transparency and user trust. The absence of security headers and vulnerability disclosure mechanisms suggests a moderate security posture. No vulnerabilities or suspicious content were detected in the HTML content. WHOIS data could not be retrieved due to query limits, but the site appears legitimate and professional. Overall, the website is functional and informative with a moderate security and privacy posture. Strategic improvements in privacy compliance, security headers, and contact transparency would enhance trust and compliance. The domain's legitimacy cannot be fully verified due to WHOIS data unavailability, but no red flags were observed in the content or technical setup.

75
60
100
75
-
-
-
tourismaccommodationhistoryculturenature+4 more
WordPressYoast SEO pluginjQueryBootstrap
2025-07-30T16:00:25.926Z