Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 125 of 516|Showing 6201-6250 of 25774
lauraedwards.net favicon

LAURA EDWARDS

lauraedwards.net

0
OtherUnited KingdomsmallMEDIUM

The website www.lauraedwards.net is a personal portfolio site primarily showcasing photography and lifestyle content. It is hosted on the Squarespace platform, leveraging modern web technologies such as Typekit fonts and Google Fonts, with a responsive design optimized for mobile devices. The site presents a professional and consistent branding experience aimed at a general audience interested in visual arts and lifestyle imagery. However, the business model appears to be individual or small-scale personal branding without explicit commercial services or e-commerce functionality. From a technical perspective, the site is built on a stable and widely used CMS platform (Squarespace), ensuring reliable hosting and performance. The site uses HTTPS with a valid SSL certificate, enhancing security and user trust. However, there is a lack of advanced security headers and no visible analytics or tracking scripts, which may limit insights into user behavior but also reduces privacy concerns. Security posture is moderate; while HTTPS is enforced, the absence of security headers and privacy policies indicates room for improvement in compliance and protection. The WHOIS data for the domain is unavailable, which is unusual and reduces the trustworthiness of the domain registration. This discrepancy suggests either recent registration, privacy protection, or data unavailability, which should be further investigated. Overall, the website is functional and visually appealing but lacks critical compliance documentation such as privacy and cookie policies. The absence of WHOIS data and security policies lowers the overall risk profile. Strategic recommendations include implementing security headers, publishing privacy and cookie policies, and clarifying domain registration details to enhance trust and compliance.

35
35
17
55
62
75
100
portfoliophotographypersonalsquarespacelifestyle
SquarespaceTypekit fontsGoogle FontsJavaScript+2
2025-10-12T16:36:32.742Z
rmkinjurylaw.com favicon

The Law Office of Richard M. Kenny

rmkinjurylaw.com

0
OtherUnited StatessmallMEDIUM

The Law Office of Richard M. Kenny is a small, highly specialized personal injury law firm based in New York City, serving clients across multiple boroughs including Manhattan, Bronx, Brooklyn, Queens, and Nassau County. The firm emphasizes a client-focused approach with a strong track record of over $500 million recovered and more than 5,000 cases prepared for trial. Their services cover a broad range of personal injury and medical malpractice claims, positioning them as a top-rated legal service provider in the NYC market. Technically, the website is built on WordPress with modern plugins such as Gravity Forms for client intake and Yoast SEO for search optimization. The site demonstrates good mobile responsiveness, accessibility, and SEO practices. Security is well implemented with HTTPS and multiple security headers, though the absence of a visible cookie consent mechanism suggests room for improvement in privacy compliance. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, the lack of WHOIS data due to privacy protection slightly reduces transparency but is common for legal firms. Overall, the site is professional, trustworthy, and well-maintained, supporting the firm's market position. Strategically, the firm should enhance privacy compliance by implementing a cookie consent banner and consider publishing explicit security and incident response policies to further build client trust and meet regulatory requirements.

65
68
17
75
75
75
100
personalinjurylawyernyclegalservicesmedicalmalpractice+2 more
WordPressGravity FormsjQueryOwl Carousel+3
2025-10-12T15:34:51.341Z
martinezlawhouston.com favicon

The Martinez Law Firm - Houston DWI Lawyer

martinezlawhouston.com

0
OtherUnited StatessmallMEDIUM

The Martinez Law Firm is a specialized legal practice based in Houston, Texas, focusing on criminal defense and DWI cases. Led by attorney Herman Martinez, the firm boasts over 25 years of experience and a strong reputation in the Houston legal market. The firm targets individuals facing criminal charges in Houston and Harris County, offering personalized and client-driven legal services. Their market position is reinforced by numerous client testimonials, awards, and a high aggregate rating, positioning them as a trusted choice for criminal defense in the region. Technically, the website is built on WordPress using WPBakery Page Builder and NitroPack for performance optimization. It employs modern web technologies and is well-optimized for SEO and mobile devices, providing a fast and user-friendly experience. Security-wise, the site uses HTTPS with good SSL configuration but lacks some security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. WHOIS data is incomplete or unavailable, which slightly reduces domain trustworthiness, but the professional website and business signals mitigate this concern. Overall, the site demonstrates strong business credibility and technical maturity with room for improvement in privacy and security transparency.

15
58
2
70
52
75
100
lawyercriminaldefensedwihoustonlegalservices+1 more
WordPressWPBakery Page BuilderNitroPackGoogle Tag Manager+2
2025-10-12T15:34:06.226Z
davidhardawaylaw.com favicon

The Law Offices of David C. Hardaway

davidhardawaylaw.com

0
OtherUnited StatessmallHIGH

The Law Offices of David C. Hardaway is a specialized criminal defense law firm based in San Marcos, Texas, serving clients primarily in Hays County and surrounding Central Texas areas. The firm offers comprehensive legal defense services including DWI, drug crimes, violent crimes, and other serious criminal charges. The website is professionally designed with rich content, detailed FAQs, attorney profiles, case results, and client testimonials, positioning the firm as a reputable and trusted legal service provider in the region. The firm holds multiple industry recognitions and certifications, enhancing its market credibility. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Swiper.js, and uses Google Fonts and Google Tag Manager for analytics and tracking. The site employs HTTPS with good SSL configuration and includes spam protection via Google reCAPTCHA on its contact form. However, it lacks visible security headers and cookie consent mechanisms, which are recommended for improved security and privacy compliance. From a security perspective, the site shows good practices like HTTPS enforcement and no exposed sensitive data, but the absence of WHOIS data for the domain raises concerns about domain registration legitimacy. Despite this, the website content and structure strongly indicate a legitimate business operation. Overall, the site scores well on content quality, business credibility, and technical implementation but should address privacy compliance and security header improvements. Strategically, the firm should verify domain registration details, implement comprehensive privacy and cookie policies with consent mechanisms, and enhance security headers to strengthen trust and compliance. These improvements will support the firm's professional image and reduce potential risks related to privacy and security.

15
53
17
70
72
75
-
lawfirmcriminaldefensedwilawyersanmarcostexas+4 more
WordPressjQuerySwiper.jsGoogle Fonts+5

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:46.044Z
farmerclinecampbell.com favicon

Farmer, Cline & Campbell Personal Injury Lawyers

farmerclinecampbell.com

0
OtherUnited StatesmediumMEDIUM

Farmer, Cline & Campbell Personal Injury Lawyers is a well-established personal injury law firm based in Charleston, West Virginia, with nearly 30 years of experience and over 300 years of combined attorney experience. The firm specializes in a wide range of personal injury cases including vehicle accidents, catastrophic injuries, and wrongful death. They have a strong market position supported by numerous legal awards, certifications, and a large volume of positive client reviews. Their business model focuses on providing expert legal representation to injured individuals in West Virginia, offering free consultations and emphasizing client trust and success. Technically, the website is built on WordPress with modern performance optimizations such as NitroPack, and integrates popular tools like Gravity Forms and Google Analytics. The site is mobile-optimized, fast-loading, and professionally designed, providing an excellent user experience. Security posture is good with HTTPS and reCAPTCHA protections, though it lacks some advanced security headers and DNSSEC. Privacy compliance is limited due to the absence of explicit privacy and cookie policies. Overall, the website reflects a credible and professional legal service provider with strong business credibility but could improve privacy transparency and security hardening.

15
53
17
40
52
75
100
personalinjurylawyerlegalserviceswestvirginiacharleston+5 more
WordPressGravity FormsNitroPackGoogle Fonts+4
2025-10-12T15:33:41.008Z
fanninglawllc.com favicon

Fanning Law, LLC

fanninglawllc.com

0
OtherUnited StatessmallMEDIUM

Fanning Law, LLC is a well-established small law firm specializing in family law services in Southern Maryland, particularly La Plata and Charles County. Led by attorney William C. Fanning Jr., the firm offers comprehensive legal assistance in divorce, child custody, support, property division, and related family law matters, with additional practice areas in personal injury, criminal defense, and business law. The website reflects a professional and client-focused approach with detailed content, testimonials, and local expertise. Technically, the website is built on WordPress with modern libraries such as jQuery and Swiper, and integrates Google Fonts and Google Tag Manager for analytics. The site is mobile-optimized, accessible, and performs moderately well. Security measures include HTTPS and Google reCAPTCHA on forms, though security headers are not detected, and privacy compliance could be improved with explicit policies and cookie consent mechanisms. The security posture is solid with no visible vulnerabilities or exposed sensitive data, but the absence of WHOIS data and domain registration details introduces some uncertainty about domain legitimacy. However, the professional presentation and detailed business information mitigate these concerns. Overall, the site is trustworthy and serves its target audience effectively. Recommendations include enhancing privacy and cookie policies, implementing security headers, publishing incident response contacts, and regular security audits to maintain compliance and trust.

55
53
17
75
72
75
-
familylawdivorcelegalservicesmarylandlawyer+3 more
WordPressjQuery 3.7.1Swiper 6.5.4Google Fonts+2

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:20.723Z
mrlevelhead.com favicon

Mr. Level Head

mrlevelhead.com

0
OtherUnited StatessmallHIGH

Mr. Level Head is a small, local handyman and home repair service provider based in Spring Hill, Florida, serving Hernando and Pasco counties. The company offers a wide range of home repair services including door repair, electrical work, painting, drywall repair, furniture assembly, plumbing, and more. The website positions the business as reliable and detail-oriented, supported by multiple positive customer testimonials and local business listings such as BBB and Yelp. The business model is straightforward, charging by the job with flexible scheduling and a one-year labor warranty, targeting homeowners and residents in the local area. Technically, the website is built on WordPress using the Elementor page builder and related plugins, leveraging modern web technologies such as jQuery, Font Awesome, and Google Fonts. The site is hosted likely via GoDaddy, with a moderate performance profile and good mobile optimization. SEO is well addressed with proper meta tags, structured data (JSON-LD), and clear navigation. However, accessibility is basic and could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and DNSSEC. No privacy or cookie policies are present, indicating compliance gaps especially regarding GDPR. There is no visible incident response or vulnerability disclosure information. Analytics and tracking are implemented via Google Analytics, Ahrefs, and StatCounter, with moderate user tracking levels but limited privacy transparency. Overall, the website is professional and trustworthy for its business purpose but would benefit from enhanced privacy compliance, improved security headers, and clearer policies to strengthen user trust and regulatory adherence.

15
35
17
55
72
80
40
handymanhomerepairlocalbusinessspringhillflhomeservices+1 more
WordPressElementorElementor ProjQuery+3
2025-10-12T15:32:50.656Z
olsson.com favicon

Olsson

olsson.com

0
OtherUnited StateslargeMEDIUM

Olsson is a nationally recognized, employee-owned engineering and design firm specializing in infrastructure solutions across multiple sectors including energy, transportation, government, telecommunications, and water. The company positions itself as a top-10 data center engineering firm with a strong emphasis on community impact and sustainability. Their website reflects a mature digital presence with comprehensive service offerings and a clear focus on client engagement and recruitment. Technically, the website is built on the Webflow platform, leveraging modern web technologies such as Google Fonts, reCAPTCHA, Microsoft Clarity, and various marketing and analytics tools. The site is well-optimized for performance, mobile responsiveness, and accessibility, providing a seamless user experience. From a security perspective, the site enforces HTTPS and integrates CAPTCHA protections on forms, demonstrating good security hygiene. However, explicit security headers and a visible cookie consent mechanism are absent, and no dedicated security or incident response policies are published. The WHOIS data is missing, which raises some concerns about domain registration transparency but does not detract significantly from the overall trustworthiness given the professional site content. Overall, Olsson's website presents a strong business and technical profile with minor gaps in privacy compliance and domain registration transparency. Strategic improvements in security policy visibility and privacy mechanisms would enhance trust and compliance.

15
53
2
85
72
85
100
engineeringdesignemployee-ownedconsultinginfrastructure+5 more
Webflow CMSGoogle FontsGoogle reCAPTCHAMicrosoft Clarity+5
2025-10-12T14:22:43.313Z
T

Travel Insured International

travelinsured.com

0
OtherN/amediumMEDIUM

Travel Insured International operates as a travel insurance provider offering plans that cover trip cancellation, baggage, and medical emergencies. The company targets travelers seeking reliable insurance coverage to protect their trips. The website presents a professional and consistent brand image with clear service offerings and a focus on travel insurance solutions. The market position appears established within the travel insurance sector, although domain registration data is missing, which raises questions about domain legitimacy. Technically, the website leverages a modern technology stack including jQuery, Bootstrap, and Sitefinity CMS, alongside multiple third-party analytics and marketing tools such as Google Tag Manager, Facebook Pixel, and Microsoft Clarity. The site is mobile-optimized and demonstrates good SEO practices, although accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the website lacks visible security headers and explicit privacy or cookie policies in the provided content, which impacts its security posture and privacy compliance. No WAF or blocking mechanisms are detected, and the site is accessible. The absence of WHOIS registration data is a critical concern for domain trustworthiness, although the website content and structure suggest a legitimate business operation. Overall, the site scores moderately on AI evaluation, with strengths in content quality and technical implementation but weaknesses in security and privacy compliance. Strategic improvements in domain registration transparency, security headers, and privacy policies are recommended to enhance trust and compliance.

65
53
55
80
65
80
100
travelinsuranceinsurancetravelmedicalcoveragebaggagecoverage+1 more
jQuery 3.6.4jQuery UI 1.11.3Bootstrap 5.1.3Bluebird Promise+8
2025-10-12T13:15:03.975Z
A

Attention Required! | Cloudflare

avoya.com

0
OtherN/asmallMEDIUM

The website avoyatravel.com is currently inaccessible due to a Cloudflare Web Application Firewall (WAF) block page. This prevents access to any meaningful content or business information, severely limiting the ability to analyze the company's services, market position, or digital presence. The domain is registered since 2005 with Cloudflare, indicating a long-standing registration, but no privacy or contact details are publicly available on the landing page. The technical infrastructure relies on Cloudflare services, including DNS and security, but no CMS or additional technologies are detectable due to the block. From a security perspective, the site is protected by Cloudflare's WAF, which is actively blocking access likely due to triggered security rules. However, no security headers or policies are visible, and DNSSEC is not enabled, representing areas for improvement. The lack of privacy and cookie policies, as well as absence of contact or incident response information, indicates poor compliance with privacy regulations and security best practices. Overall, the site’s risk profile is elevated due to the lack of accessible content and transparency. The WAF block suggests active security measures but also hinders trust and user experience. Strategic recommendations include enabling DNSSEC, publishing privacy and cookie policies, providing clear contact information, and ensuring the site is accessible to legitimate users to improve trust and compliance.

35
35
2
85
52
85
100
blockedcloudflaresecuritywafaccessdenied
CloudflareJavaScript
2025-10-12T13:14:27.677Z
allianzpartners.com favicon

Allianz Partners

allianzpartners.com

0
OtherUnited StatesenterpriseMEDIUM

Allianz Partners is a global leader in specialty insurance, focusing on travel, tuition, event ticket, bankcard, and assistance services. The website presents a professional and consistent brand image aligned with the parent company Allianz SE. The business model centers on providing insurance products and technology solutions to partners and their customers in the US market. The site is well-structured with comprehensive product information, customer testimonials, and corporate details, targeting insurance partners and end customers. Technically, the website is built on Adobe Experience Manager CMS with modern JavaScript frameworks and includes GDPR-compliant cookie consent mechanisms. The site is mobile-optimized and uses embedded media and social media integrations. Performance is moderate with room for improvement in accessibility and security headers. Security posture is adequate with HTTPS and cookie consent but lacks explicit security policies and incident response information. No critical vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data for the domain is a concern but may be due to proxy registration or subdomain usage. Overall, the site demonstrates a mature digital presence with good privacy compliance and business credibility. Strategic recommendations include enhancing security headers, publishing security and incident response policies, adding vulnerability disclosure mechanisms, and improving accessibility compliance to strengthen trust and security culture.

80
85
2
40
85
75
100
insurancetravelinsurancespecialtyinsuranceallianzpartnerscorporate+8 more
JavaScriptjQueryAdobe Experience Manager (AEM)OneTrust (cookie consent)+2

Partner Domains:

www.allianz.com
parent
www.allianztravelinsurance.com
related
2025-10-12T12:06:16.769Z