Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 294 of 516|Showing 14651-14700 of 25766
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

0
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
sheppardmullin.com favicon

Sheppard Mullin

sheppardmullin.com

0
OtherUnited StateslargeMEDIUM

Sheppard Mullin is a prominent AmLaw 100 law firm with a broad international presence across the United States, Europe, and Asia. The firm offers a comprehensive range of legal services spanning numerous practice areas including corporate law, litigation, intellectual property, privacy and cybersecurity, and more. Their website reflects a mature digital presence with professional branding, clear navigation, and extensive content tailored to corporate clients and legal professionals. The firm positions itself as a leader in the legal industry with recognized awards and a strong market reputation. From a technical perspective, the website employs modern web technologies including Google Tag Manager, Adobe DTM, and various analytics and marketing pixels. The site is mobile-optimized and includes accessibility features such as the UserWay widget, indicating a commitment to compliance and user inclusivity. Performance is moderate with good SEO and accessibility standards met. Security-wise, the site enforces HTTPS and uses several best practices, though it lacks explicit security headers and a public security policy or vulnerability disclosure page. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low risk profile with a high degree of professionalism and trustworthiness. The absence of WHOIS data is a notable anomaly but does not detract significantly from the site's legitimacy given the comprehensive and consistent business information presented. Strategic recommendations include enhancing security headers, publishing a security policy, and adding a vulnerability disclosure mechanism to further strengthen trust and security posture.

70
68
47
70
67
85
100
lawfirmlegalservicesamlaw100privacypolicycookiepolicy+2 more
JavaScriptGoogle Tag ManagerSiteimprove AnalyticsLinkedIn Insight Tag+3
2025-07-07T05:32:42.180Z
schwabe.com favicon

Schwabe

schwabe.com

0
OtherUnited StateslargeMEDIUM

Schwabe is a well-established regional law firm with over 130 years of history, focusing on providing tailored legal services across various industries in the Northwest United States. Their website reflects a professional and comprehensive presentation of their services, emphasizing industry-specific expertise and client commitment. The firm targets businesses and legal professionals seeking specialized counsel in sectors such as manufacturing, healthcare, natural resources, maritime, real estate, and technology. The business model centers on delivering legal solutions aligned with regional and industry needs, positioning Schwabe as a trusted legal partner in their market. Technically, the website is built on WordPress and incorporates modern web technologies including Google Fonts, Google Tag Manager, and New Relic for performance monitoring. The site is mobile-optimized, accessible, and SEO-friendly, with a fast to moderate performance profile. Security measures include HTTPS enforcement, use of Google reCAPTCHA on forms, and a cookie consent mechanism, indicating a mature digital infrastructure. From a security perspective, the site demonstrates good practices such as encrypted connections and bot protection. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. The absence of WHOIS data reduces transparency but does not detract significantly from the site's legitimacy given the professional presentation and consistent branding. Overall, Schwabe's website presents a low-risk profile with strong business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing security policies, and improving WHOIS transparency to further strengthen trust and compliance.

25
53
2
70
95
80
100
lawfirmlegalservicesprofessionalservicesregionalbusinessindustryfocused
WordPressGoogle FontsGoogle Tag ManagerGoogle reCAPTCHA+2
2025-07-07T05:32:32.166Z
wwhgd.com favicon

Weinberg Wheeler

wwhgd.com

0
OtherUnited StatesmediumMEDIUM

Weinberg, Wheeler, Hudgins, Gunn & Dial, LLC is a national litigation law firm specializing in complex, high-exposure cases, particularly in construction law and catastrophic legal disputes. The firm positions itself as a bold and innovative advocate with extensive trial and arbitration experience across multiple states. Their website reflects a professional and polished digital presence, targeting corporate clients, insurance carriers, and legal professionals seeking expert litigation services. The firm emphasizes its strategic approach and proven track record through client testimonials and detailed service descriptions. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, WebP images for optimized media delivery, and HTML5 video content. The site is mobile-optimized with good accessibility and SEO practices. However, no CMS or hosting provider details are explicitly identified. Performance is moderate with room for improvement in security header implementation. From a security perspective, the site uses HTTPS and has a cookie consent mechanism aligned with privacy regulations, including GDPR compliance. However, no explicit security policies or incident response contacts are published, and security headers are not detected, which could be improved to enhance protection and trust. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness from a domain registration standpoint. Overall, the website is professional and trustworthy in content and design but would benefit from improved domain registration transparency and enhanced security practices to strengthen its risk posture and compliance stance.

55
68
17
70
72
80
100
lawfirmlitigationconstructionlawtrialadvocacylegalservices+3 more
Google AnalyticsGoogle Tag ManagerSlick CarouselCustom JavaScript+2
2025-07-07T05:32:22.151Z
irell.com favicon

Irell & Manella LLP

irell.com

0
OtherUnited StatesmediumMEDIUM

Irell & Manella LLP is a reputable law firm specializing in high-stakes business litigation, including patent litigation, securities fraud defense, and complex contract disputes. The firm is recognized for achieving exceptional client outcomes and holds ISO 27001 certification, underscoring its commitment to information security. The website presents a professional and well-structured digital presence targeting corporate clients and legal professionals. Technically, the website employs modern web technologies including Google Tag Manager for analytics and tracking, with good mobile optimization and accessibility features. The site uses HTTPS with an excellent SSL configuration, though security headers are not explicitly detected. Privacy compliance is strong with a comprehensive privacy policy and cookie consent mechanism. Security posture is solid, supported by ISO 27001 certification and secure website practices, but could be improved by adding visible security headers and publishing incident response or vulnerability disclosure information. The absence of WHOIS data is unusual but does not detract significantly from the site's legitimacy given the professional content and trust signals. Overall, the website is trustworthy, professional, and secure with minor areas for improvement in security transparency and contact information visibility.

40
53
17
65
72
80
100
lawfirmbusinesslitigationpatentlitigationiso27001legalservices
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:32:17.143Z
aalrr.com favicon

Atkinson, Andelson, Loya, Ruud & Romo

aalrr.com

0
OtherUnited StateslargeMEDIUM

Atkinson, Andelson, Loya, Ruud & Romo is a well-established California-based law firm with over 40 years of experience and a large team of over 200 attorneys across nine offices. The firm offers a broad range of legal services including labor and employment law, corporate finance, education law, litigation, and public safety, targeting both public and private sector clients. Their market position is strong within California, supported by awards, client testimonials, and recognized diversity initiatives. Technically, the website employs modern web technologies such as jwplayer for media, Google Analytics and Tag Manager for tracking, and HubSpot for marketing and analytics. The site is well-structured, mobile-optimized, and accessible, with good SEO practices and a comprehensive cookie consent mechanism. However, no CMS or hosting provider details were explicitly identified. From a security perspective, the site enforces HTTPS and provides cookie consent management, but lacks explicit security headers and a published security policy or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS domain registration data is a notable concern, potentially indicating privacy protection or a registration anomaly, which slightly impacts trustworthiness. Overall, the website is professional, trustworthy, and compliant with privacy regulations, but would benefit from enhanced transparency in domain registration and explicit security policies to improve its security posture and business credibility.

40
83
17
80
62
80
100
legallawfirmcaliforniaattorneysprivacy+4 more
jwplayerGoogle AnalyticsGoogle Tag ManagerHubSpot+2
2025-07-07T05:32:12.136Z
calfee.com favicon

Calfee, Halter & Griswold LLP

calfee.com

0
OtherUnited StateslargeMEDIUM

Calfee, Halter & Griswold LLP is a well-established full-service corporate law firm with over 120 years of experience, serving clients primarily in the Midwest United States but also nationally and globally through its partnership with Lex Mundi. The firm offers a broad range of legal services including corporate and finance, litigation, intellectual property, government relations, and various business support practices. The website reflects a mature and professional organization with strong market positioning and client trust evidenced by industry rankings and testimonials. Technically, the website employs modern web technologies such as jwplayer for media, Google Tag Manager, and LinkedIn Insight for analytics and marketing. The site is well-structured, mobile-optimized, and demonstrates good SEO and accessibility practices. Privacy and cookie policies are clearly presented with consent mechanisms, indicating compliance with GDPR and other privacy regulations. From a security perspective, the site uses HTTPS and secure forms, but lacks explicit security headers and a published security.txt file. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is not publicly available, which slightly reduces transparency but is not uncommon for professional services firms. Overall, the website presents a low-risk profile with strong business credibility and good security hygiene. Strategic improvements in security header implementation and incident response transparency would further enhance trust and resilience.

40
68
47
85
72
85
100
lawfirmcorporatelawintellectualpropertylitigationgovernmentrelations+4 more
jwplayerGoogle Tag ManagerLinkedIn Insight TagTypekit Fonts

Partner Domains:

connect.calfee.com
service
www.linkedin.com
partner

+3 more partners

2025-07-07T05:32:07.128Z
stinson.com favicon

Stinson LLP

stinson.com

0
OtherUnited StateslargeMEDIUM

Stinson LLP is a well-established law firm providing a broad range of legal services to individuals, privately held enterprises, national companies, and international public corporations. The firm emphasizes practical legal guidance, risk minimization, and opportunity realization, supported by a collaborative culture and extensive legal knowledge. Their market position is strong, with multiple office locations across the United States and recognition in legal rankings such as Chambers USA. The website reflects a professional and trustworthy brand with clear navigation and comprehensive content. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, uses web fonts for branding consistency, and implements HTTPS with good security practices. The site is mobile optimized and accessible, with cookie consent mechanisms in place indicating GDPR compliance awareness. However, some advanced security headers are missing, and no explicit security policy or incident response contact information is published. From a security perspective, the site demonstrates a solid posture with HTTPS enforced and secure form handling. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data is notable but does not detract significantly from the site's legitimacy given the professional content and external trust signals. Overall, the site scores well on content quality, technical implementation, security, privacy compliance, and business credibility, making it a reliable and professional online presence for Stinson LLP.

55
68
17
65
72
85
100
lawfirmlegalservicesattorneysprofessionalservicesprivacypolicy+2 more
Google AnalyticsGoogle Tag ManagerWeb fonts (Brandon Grotesque, Freight Text Pro)JavaScript+2

Partner Domains:

paytrace.com
partner
firmseek.com
partner
2025-07-07T05:32:02.121Z
baileyglasser.com favicon

Bailey & Glasser, LLP

baileyglasser.com

0
OtherUnited StatesmediumMEDIUM

Bailey & Glasser, LLP is a nationally recognized law firm specializing in high-stakes litigation and corporate law. The firm serves a diverse clientele including corporations, government entities, individuals, and consumer classes, offering a broad range of legal services such as business litigation, personal injury, class actions, and appellate advocacy. The firm holds a strong market position supported by multiple prestigious awards and rankings, reflecting its expertise and reputation in the legal industry. Technically, the website demonstrates a mature digital infrastructure with modern tracking and analytics tools, good mobile optimization, and a professional design that supports user engagement and trust. Security posture is solid with HTTPS enforcement and secure form practices, although there is room for improvement in implementing comprehensive security headers and publishing explicit security policies. Privacy compliance is well addressed with clear cookie consent mechanisms and a comprehensive privacy policy. Overall, the website and business present a high level of professionalism and trustworthiness, though the absence of WHOIS data limits domain registration transparency. Strategic recommendations include enhancing security header implementation, publishing incident response information, and considering a vulnerability disclosure policy to further strengthen security and trust.

40
68
17
70
52
80
100
lawfirmlitigationcorporatelawlegalservicesclassactions+3 more
Google Tag ManagerGoogle Analytics (gtag.js)HotjarFacebook Pixel+3

Partner Domains:

thebaileyglasserblog.com
partner
www.firmseek.com
partner
2025-07-07T05:31:52.100Z
porterhedges.com favicon

Porter Hedges LLP

porterhedges.com

0
OtherUnited StateslargeMEDIUM

Porter Hedges LLP is a well-established law firm specializing in sophisticated transactions and complex litigation across multiple industries including energy, real estate, finance, and corporate law. The firm is recognized for its depth of experience and ability to meet client business objectives, holding a strong market position particularly in Texas. The website reflects a professional and comprehensive presentation of their services, targeting public and private companies seeking legal expertise. Technically, the website employs modern web technologies such as jwplayer for multimedia, Google Tag Manager for analytics, and Typekit for fonts. The site is well-structured, mobile-optimized, and accessible, with good SEO practices. However, some improvements could be made in security headers and privacy compliance mechanisms. Security posture is solid with HTTPS enforced and secure form handling, but lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data reduces domain trust slightly but the professional content and external recognitions support legitimacy. Overall, the website is a strong digital asset for Porter Hedges LLP, though enhancing privacy compliance and security transparency would further strengthen trust and compliance posture.

40
53
2
70
95
85
100
lawfirmlegalservicesbankruptcycorporatelawenergylaw+2 more
jwplayerGoogle Tag ManagerTypekit FontsJavaScript+1
2025-07-07T05:31:47.092Z
cvcorner.com favicon

CVCorner

cvcorner.com

0
OtherN/asmallMEDIUM

CVCorner is a specialized job board platform established in 2013 that focuses on helping candidates reinvent their careers by connecting them with over 300 companies actively seeking new employees. The platform offers job listings, company registration, and career resources such as guides for writing professional CVs and cover letters. It also fosters community engagement through dedicated 'corners' for students and other groups. The website is multilingual and targets job seekers and employers, positioning itself as a niche player in the recruitment market. Technically, CVCorner employs a modern frontend stack including Bootstrap 5, jQuery, and popular UI libraries like Slick Slider and SweetAlert, ensuring a responsive and user-friendly experience. The site is hosted under a domain registered with EuroDNS S.A., with a stable registration history and no privacy protection, indicating transparency. Security-wise, the site uses HTTPS and has domain transfer protections but lacks DNSSEC and visible security headers, suggesting room for improvement in hardening its security posture. Privacy compliance is addressed with clear privacy and cookie policies and a consent mechanism, though no explicit security or incident response policies are published. Overall, CVCorner presents a professional and trustworthy online presence with moderate technical maturity and a good security baseline.

45
68
2
70
82
70
100
jobboardcareeremploymentrecruitmentmultilingual+2 more
jQueryBootstrap 5Slick SliderSweetAlert+2
2025-07-07T05:31:32.027Z
mmlk.com favicon

McBrayer PLLC

mmlk.com

0
OtherUnited StatesmediumMEDIUM

McBrayer PLLC is a well-established law firm serving the Kentucky business community since 1963. The firm offers a broad range of legal services including corporate law, real estate, healthcare, intellectual property, and employment law. It maintains a strong regional presence with offices in Lexington, Louisville, and Frankfort, and is affiliated with global legal networks such as Meritas and SCG Legal, enhancing its market position and service capabilities. The website reflects a professional and trustworthy brand with comprehensive content and clear navigation aimed at business clients and professionals in the region. Technically, the website employs modern web technologies including Google Tag Manager, Facebook Pixel, LinkedIn Insight Tag, and jwplayer for media content. The site is served over HTTPS with no visible security vulnerabilities in the HTML content. However, there is room for improvement in privacy compliance, particularly the absence of a cookie consent banner and security headers. Mobile optimization and accessibility are basic but functional, supporting a moderate user experience. From a security perspective, the site demonstrates good practices such as HTTPS enforcement and use of secure analytics scripts. The lack of WHOIS data for the domain is a concern, as it reduces transparency and trustworthiness. No security policy or incident response information is published, which could be enhanced to improve security posture and client confidence. Overall, the site is secure and professional but could benefit from enhanced privacy and security disclosures. The overall risk assessment is moderate with a high level of business credibility but some technical and compliance gaps. Strategic recommendations include implementing a cookie consent mechanism, adding security headers, publishing a security policy, and verifying domain registration details to strengthen trust and compliance.

45
58
17
85
62
85
100
lawfirmlegaladvicekentuckylitigationcorporatelaw+4 more
jwplayerGoogle Tag ManagerGoogle Analytics (gtag.js)Facebook Pixel+2

Partner Domains:

www.mmlkgov.com
partner
www.meritas.org
partner

+1 more partners

2025-07-07T05:31:22.008Z
objectrotterdam.com favicon

OBJECT Rotterdam

objectrotterdam.com

0
OtherNetherlandssmallMEDIUM

OBJECT Rotterdam is a niche design fair based in the Netherlands, focusing on contemporary design, art, and fashion. The website serves as a platform to showcase participants, archive past editions, and provide press and contact information. The business targets design professionals, enthusiasts, and media, operating primarily as an event organizer and promoter within the creative industry. The domain has been registered since 2006, consistent with the business's longevity and reputation. Technically, the website is built on WordPress with common plugins and libraries such as jQuery and FontAwesome. It is hosted on a Dutch hosting provider, Hostnet, and employs HTTPS with a good SSL configuration. The site is moderately optimized for performance and mobile devices, with good SEO practices but basic accessibility features. Tracking tools like Google Analytics and Facebook Pixel are used, indicating moderate user tracking. From a security perspective, the site uses HTTPS and has domain transfer protections enabled, but lacks DNSSEC and important security headers. There is no visible privacy or cookie policy, which is a compliance gap. No incident response or vulnerability disclosure information is provided. The site is not blocked by any WAF or security challenge, allowing full content access. Overall, the website is professional and credible but would benefit from enhanced privacy compliance and security hardening. Strategic improvements in these areas would strengthen trust and regulatory adherence.

15
35
2
70
95
80
100
designartexhibitionrotterdamfashion+1 more
WordPress 5.9.10jQuery 3.6.0FontAwesomeGoogle Analytics+1
2025-07-07T05:30:21.689Z
bluestar.co.nz favicon

Blue Star Group (New Zealand) Limited

bluestar.co.nz

0
OtherNew ZealandlargeMEDIUM

Blue Star Group (New Zealand) Limited is a leading print communications company based in New Zealand, specializing in integrated marketing execution services including print, packaging, design, customer communications, merchandise, and logistics. The company positions itself as a pragmatic and agile partner for Kiwi businesses, offering comprehensive solutions to enhance customer engagement. The website reflects a professional and consistent brand image with clear service offerings and a focus on quality and innovation. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and jQuery, supplemented by marketing and analytics tools like HubSpot and Google Analytics. The site is mobile-optimized and demonstrates good SEO practices, though accessibility features could be improved. Performance is moderate, with no critical technical issues detected. From a security perspective, the site employs HTTPS and demonstrates commitment to security best practices, evidenced by ISO/IEC 27001 certification and a cookie consent mechanism. However, security headers are not explicitly detected, and there is no public vulnerability disclosure or incident response contact information. No vulnerabilities or exposed sensitive data were found in the analyzed content. Overall, the website presents a low risk profile with strong business credibility and privacy compliance. The absence of WHOIS data limits domain trust verification but does not detract significantly from the overall assessment. Strategic recommendations include enhancing security headers, publishing incident response contacts, and improving accessibility compliance.

70
68
2
90
72
75
100
printpackagingdesigncommunicationmerchandise+3 more
jQueryBootstrap 4.3.1Slick CarouselFlexslider+2
2025-07-07T04:26:12.806Z
autexglobal.com favicon

Autex

autexglobal.com

0
OtherNew ZealandlargeMEDIUM

Autex is a New Zealand-based company specializing in the design and supply of acoustic panels and insulation products. The company positions itself as a leader in the acoustic solutions market in New Zealand, emphasizing sustainability and carbon-neutral products. Their website showcases a modern, professional design with detailed product information and project case studies, targeting architects, builders, designers, and consumers seeking acoustic solutions. The technical infrastructure is built on modern web technologies including Next.js and React, with integrations for analytics and marketing tools such as Google Tag Manager, Hotjar, Facebook Pixel, and HubSpot. The website is well-optimized for SEO, mobile responsiveness, and accessibility, providing a fast and user-friendly experience. Security posture is good with HTTPS enforced and no obvious vulnerabilities, though explicit security headers and published security policies are absent. Privacy compliance is limited due to missing privacy and cookie policies and consent mechanisms. The absence of WHOIS data reduces domain trustworthiness, suggesting the domain may be new or privacy protected, which warrants further verification. Overall, the website reflects a credible and professional business presence with room for improvement in privacy and security transparency.

15
68
2
85
82
60
100
acousticpanelscarbonneutralsustainabilitynewzealandinsulation+2 more
ReactNext.jsGoogle Tag ManagerHotjar+4
2025-07-07T04:25:37.742Z
grafyska.nl favicon

Grafyska

grafyska.nl

0
OtherNetherlandssmallMEDIUM

Grafyska is a small creative design agency based in the Netherlands, founded in 2020. The company specializes in graphic design, web design, and social media marketing services aimed at businesses seeking distinctive and effective visual communication. Their website demonstrates a strong brand identity with professional design and clear navigation, targeting business clients who want to enhance their marketing presence. The site includes customer testimonials and links to social media channels, reinforcing trust and engagement. Technically, the website employs modern web technologies including JavaScript, CSS, SVG graphics, and Alpine.js for interactivity. It is mobile-optimized and performs well with fast loading times. The site uses multiple tracking and marketing tools such as Google Analytics, Microsoft Clarity, Facebook Pixel, and Pinterest Tag, but lacks a cookie consent mechanism, which is a privacy compliance gap. The domain is secured with HTTPS and anonymizes IP addresses in analytics, reflecting a moderate privacy posture. From a security perspective, the website has a good SSL configuration but lacks security headers and published security policies or incident response contacts. No vulnerabilities or exposed sensitive data were detected in the HTML content. The WHOIS data is consistent with the business claims, showing a domain registration date in 2020 and no privacy protection, which supports legitimacy. Overall, the security posture is adequate but could be improved with additional headers and privacy controls. The overall risk assessment is low, with the main recommendations focusing on enhancing privacy compliance by implementing cookie consent, adding security headers, and publishing security and incident response policies. These improvements would strengthen trust and reduce potential compliance risks while maintaining the website's professional and user-friendly experience.

80
28
2
70
75
75
100
graphicdesignwebdesignsocialmediamarketingcreativeagencynetherlands
JavaScriptCSSHTMLTypekit Fonts+1

Partner Domains:

greateplanner.nl
partner
grafyska.com
partner

+2 more partners

2025-07-07T04:23:52.502Z
debestuurskamer.nl favicon

De Bestuurskamer BV

debestuurskamer.nl

0
OtherNetherlandssmallMEDIUM

De Bestuurskamer BV is a specialized consulting and coaching firm based in the Netherlands, focusing on providing support to executives, supervisory boards, and leadership teams. Their services include acting as a conversation partner for directors and supervisors, assisting with boardroom issues, and offering personal growth and coaching for leaders. The company positions itself as a trusted advisor with experienced professionals who have backgrounds in governance and executive leadership. The website reflects a professional and consistent brand image targeting a niche market of governance and leadership consulting. Technically, the website is built on the Webflow platform, utilizing modern JavaScript libraries such as jQuery and Splide Slider for UI components, and is hosted on a CDN (Amazon CloudFront). The site is mobile-optimized, fast-loading, and includes Google Tag Manager for analytics, although IP anonymization is disabled. The technical implementation is solid with good SEO and accessibility features, but lacks some advanced security headers and cookie consent mechanisms. From a security perspective, the site uses HTTPS with a strong SSL configuration and does not expose sensitive data. However, it lacks explicit security policies, incident response contacts, and cookie consent banners, which are important for GDPR compliance. The WHOIS data aligns well with the business claims, showing a consistent and legitimate registration. No WAF or blocking mechanisms are detected, and no vulnerabilities or suspicious content were found. Overall, the website demonstrates a high level of professionalism and trustworthiness with minor gaps in privacy compliance and security best practices. Strategic improvements in cookie consent, security headers, and privacy policy detail would enhance the site's compliance and security posture.

30
10
2
80
72
70
100
consultingexecutivecoachinggovernanceboardroomleadership+3 more
jQuerySplide SliderGoogle Tag ManagerWebflow CMS+1
2025-07-07T03:19:07.641Z
plantiblefoods.com favicon

Plantible Foods, Inc.

plantiblefoods.com

0
OtherUnited StatesmediumMEDIUM

Plantible Foods, Inc. is a biology company specializing in sustainable, plant-based protein ingredients, primarily focusing on Rubi Protein™ derived from Lemna aquatic plants. Their business model targets food manufacturers and product developers seeking non-GMO, nutritious, and environmentally responsible protein sources. The company positions itself as an innovator in the plant-based protein market with a scalable and sustainable supply chain. Technically, the website is built on modern web technologies including Webflow CMS, jQuery, Splide.js for sliders, and integrates HubSpot for forms and analytics. The site is well-optimized for performance, mobile responsiveness, and SEO, with a professional design and clear navigation. From a security perspective, the site enforces HTTPS and uses secure third-party services for form handling and analytics. However, it lacks explicit security headers and does not provide a dedicated security policy or incident response contact. The absence of WHOIS domain registration data raises concerns about domain legitimacy, although the website content and business information appear credible and professional. Overall, the website presents a strong digital presence with good content quality and technical implementation. The main risk lies in the missing WHOIS data and limited direct contact information, which should be addressed to enhance trust and compliance.

60
68
2
70
62
75
100
plant-basedsustainableproteinfoodnutrition+3 more
jQuerySplide.jsHubSpot forms and analyticsGoogle Tag Manager+2
2025-07-07T03:18:37.577Z
jonathanwarner.nl favicon

Jonathan Warner

jonathanwarner.nl

0
OtherNetherlandssmallMEDIUM

Jonathan Warner is a Netherlands-based leadership consultancy specializing in providing human-centric leadership solutions at the board, team, and individual levels. The company positions itself as a trusted advisor offering tailored leadership development and governance optimization services. The website reflects a professional and consistent brand image with rich content including client case studies and insights, targeting leadership professionals and organizations seeking to improve leadership effectiveness. Technically, the website is built on the Webflow platform, leveraging modern JavaScript libraries such as jQuery and GSAP for animations and user experience enhancements. The site is mobile-optimized and accessible, with good SEO practices evident in meta tags and structured content. Hosting is managed by Webflow, ensuring reliable performance, though some performance optimizations could be considered. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks several important security headers and does not implement a cookie consent mechanism, which impacts GDPR compliance. No explicit security policies or incident response contacts are published, indicating room for improvement in security transparency and readiness. Overall, the website is trustworthy and professional but would benefit from enhanced privacy compliance measures and security best practices to strengthen its risk posture and user trust.

30
25
2
70
72
60
100
leadershipconsultingboardsgovernanceteamdevelopment+1 more
jQueryGSAPLenisSwiper+1
2025-07-07T03:18:12.517Z
R

Access Denied

rjf.com

0
OtherN/aMEDIUM

The website rjf.com is currently inaccessible due to a Web Application Firewall (WAF) or security mechanism blocking access, as evidenced by the 'Access Denied' error page served with minimal HTML content and references to Akamai EdgeSuite error URLs. This prevents any direct analysis of the website's content, metadata, or business information. The domain itself is well-established, having been registered since 1994 with MarkMonitor Inc., a reputable registrar, indicating a legitimate and longstanding business presence. However, no direct business, security, or compliance information is available from the site due to the access restrictions. From a technical perspective, the domain uses Akamai's CDN infrastructure as inferred from the nameservers, which suggests a robust hosting and content delivery setup. The lack of DNSSEC is a minor security gap but not uncommon. The absence of accessible content means no evaluation of the website's design, SEO, or user experience can be performed. Security posture evaluation is limited by the lack of accessible content and headers; however, the presence of a WAF indicates some level of security enforcement. No privacy policies, cookie consent mechanisms, or incident response information are detectable, which may be present on the actual site if accessible. Overall, the risk assessment is constrained by the blocked content, but the domain registration data supports legitimacy. Strategic recommendations include verifying access permissions to enable full content analysis, ensuring DNSSEC is enabled for enhanced DNS security, and confirming the presence of comprehensive privacy and security policies once the site is accessible.

15
50
17
85
62
85
100
accessdeniedwafblockedsecurityakamai
2025-07-07T03:17:52.355Z
meritas.org favicon

Meritas

meritas.org

0
OtherUnited StatesmediumMEDIUM

Meritas is a well-established global alliance of independent law firms, founded in 1990 and headquartered in the United States. The organization provides clients worldwide with access to top-tier legal expertise through its member firms. The website reflects a professional and consistent brand image, offering detailed information about member firms, legal insights, and contact options. The business model centers on facilitating legal services globally without direct legal practice, positioning Meritas as a premier legal network. Technically, the website employs modern web technologies including Vue.js, Google Analytics, and Cloudflare DNS services. The site is mobile-optimized, accessible, and SEO-friendly, with good performance characteristics. However, some improvements could be made in security headers and cookie consent mechanisms to enhance compliance and security posture. From a security perspective, the site uses HTTPS with strong domain management practices including domain locks. No critical vulnerabilities or suspicious content were detected. However, the absence of security policies, incident response contacts, and cookie consent mechanisms indicates room for improvement in privacy compliance and security transparency. Overall, the website presents a low-risk profile with strong business credibility and technical maturity. Strategic enhancements in security policies and privacy compliance would further strengthen trust and regulatory adherence.

35
53
2
70
75
80
100
legallawfirmsglobalnetworkprofessionalserviceslegalinsights
Google AnalyticsGoogle Tag ManagerCloudflare DNSVue.js (implied by #vueApp and bundle.js)+1
2025-07-07T03:16:42.218Z
B

Index of /

blstaging.com.au

0
OtherAustraliasmallHIGH

The website at blstaging.com.au currently serves as a simple directory index page with minimal content and no business-related information. It appears to be a staging or placeholder site rather than a fully developed business website. The domain is registered with an Australian registrar, Synergy Wholesale Accreditations Pty Ltd, and uses standard name servers without DNSSEC enabled. The site is hosted on a LiteSpeed Web Server and includes basic JavaScript for table sorting but lacks metadata, structured data, or any forms and contact details. From a technical perspective, the site demonstrates basic HTTPS support but lacks important security headers and modern SEO or accessibility features. There are no privacy, cookie, or terms of service policies present, indicating low compliance with privacy regulations such as GDPR. No analytics, advertising, or tracking technologies are detected, suggesting minimal user data collection. Security posture is weak due to missing security headers and lack of DNSSEC, though no critical vulnerabilities or malware indicators are found. The WHOIS data is consistent and legitimate, with no privacy protection or suspicious patterns. Overall, the site scores low on content quality, technical implementation, security, privacy compliance, and business credibility, reflecting its staging or placeholder nature. Strategic recommendations include implementing standard security headers, enabling DNSSEC, adding privacy and cookie policies, providing clear contact and incident response information, and improving SSL configuration. Enhancing website content and business information will also improve trust and credibility.

15
50
2
85
72
60
20
LiteSpeed Web Servertablesort.jstablesort.number.js
2025-07-07T03:16:27.191Z
maakbaarleuven.be favicon

Maakbaar Leuven vzw

maakbaarleuven.be

0
OtherBelgiumsmallMEDIUM

Maakbaar Leuven vzw is a small non-profit organization based in Belgium focused on reducing electronic waste through repair and reuse of small electronic devices. The organization collaborates with citizens and other organizations to lead local initiatives against e-waste. Their website reflects a clear mission and community-oriented business model, positioning them as a local leader in environmental sustainability efforts related to electronics. Technically, the website is built on WordPress using the Astra theme and Elementor page builder, with modern technologies such as Google Tag Manager and CookieYes for consent management. The site is hosted likely on SiteGround, performs moderately well, and is optimized for mobile devices. SEO practices are good, with proper metadata and structured data implemented. From a security perspective, the site uses HTTPS with a good SSL configuration and includes a cookie consent mechanism, indicating awareness of privacy compliance. However, it lacks explicit security headers and published security policies or incident response information. No critical vulnerabilities or suspicious activities were detected. Overall, the website is professional, trustworthy, and compliant with basic privacy standards, though it could improve by publishing privacy and security policies and enhancing security headers. The domain registration is consistent with the organization's profile, supporting legitimacy and trustworthiness.

35
83
2
65
72
65
-
e-wasterepairreusenon-profitenvironment+2 more
WordPressElementorjQueryGoogle Tag Manager+2
2025-07-07T03:14:36.885Z