Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 57 of 70|Showing 2801-2850 of 3460
bonava.de favicon

Bonava

bonava.de

0
Real EstateGermanylargeMEDIUM

Bonava is a large real estate developer operating nationwide in Germany, specializing in the development and sale of newly built houses and condominiums. The website targets prospective home buyers looking for new residential properties across Germany. The company presents itself with a professional and consistent brand image, supported by a well-structured and visually appealing website. The content is relevant and focused on real estate offerings, with clear navigation and good mobile optimization. Technically, the website employs modern JavaScript libraries and tracking tools such as Google Tag Manager and Azure App Insights, along with OneTrust for cookie management. While the site uses HTTPS and includes Google site verification, explicit security headers and detailed security policies are not evident in the provided content. The site shows moderate performance and basic accessibility features. From a security perspective, the website demonstrates basic best practices but lacks visible security policies, incident response contacts, or vulnerability disclosure mechanisms. No critical vulnerabilities or suspicious patterns were detected, and the domain appears legitimate based on WHOIS data. Privacy compliance is limited due to the absence of explicit privacy and cookie policies in the analyzed content. Overall, the website is professional and trustworthy for its business purpose but would benefit from enhanced transparency in privacy, security policies, and compliance documentation to improve user trust and regulatory adherence.

45
33
2
85
72
70
100
realestatenewbuildhousingcondominiumsgermany+1 more
JavaScriptModernizrGoogle Tag ManagerOneTrust Cookie Consent+1
2025-07-06T12:18:00.699Z
M

MARQ

marqproperty.com.au

0
Real EstateAustraliamediumMEDIUM

MARQ is a well-established Canberra-based real estate company specializing in property sales, management, buying, and renting services. Founded in 2010, it positions itself as a leader in the local real estate market, offering comprehensive services to property investors, homeowners, tenants, and buyers. The website reflects a professional and consistent brand image with rich content tailored to its target audience in the Canberra region. Technically, the website is built on WordPress with a modern tech stack including jQuery, Google Maps API, Vimeo embeds, and Gravity Forms for data collection. It leverages Cloudflare for DNS and CDN services, ensuring good performance and availability. SEO practices are well implemented with Yoast SEO plugin and structured data, enhancing search visibility. From a security perspective, the site enforces HTTPS and uses asynchronous loading for analytics and tracking scripts such as Google Tag Manager and Facebook Pixel. However, it lacks some advanced security headers and does not provide explicit security or incident response policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. Overall, MARQ's website demonstrates a solid digital presence with good content quality and business credibility. Security posture is adequate but could be improved with additional headers and policies. Privacy compliance should be enhanced to meet modern standards. The risk level is moderate with no critical vulnerabilities detected.

15
53
17
55
62
65
100
realestatepropertycanberrabuysell+3 more
WordPressjQueryGoogle Maps APIVimeo embed+3
2025-07-06T08:58:53.283Z
property-in-bulgaria.bg favicon

Registry Agency at the Ministry of Justice of the Republic of Bulgaria

property-in-bulgaria.bg

0
Real EstateBulgariasmallHIGH

The website property-in-bulgaria.bg is an official government-backed informational portal managed by the Registry Agency at the Ministry of Justice of the Republic of Bulgaria. It serves foreign nationals interested in acquiring and managing real estate in Bulgaria by providing comprehensive guidance on legal rights, buying and selling processes, property management, taxes, and fraud prevention. The site is multilingual and references Bulgarian legislation, positioning itself as a trusted resource in the real estate sector for international users. Technically, the site is built on Joomla CMS and uses older JavaScript libraries such as jQuery 1.6 and MooTools, alongside Google Analytics for user tracking. Hosting appears to be provided by SuperHosting.BG, consistent with the Bulgarian domain and nameservers. The website design is basic but functional, with moderate performance and limited mobile optimization. SEO and accessibility features are present but minimal. From a security perspective, the site uses HTTPS but lacks visible security headers and employs outdated JavaScript libraries, which may expose it to vulnerabilities. No privacy or cookie policies are explicitly found, though GDPR compliance is implied by the WHOIS privacy protection and the site's government affiliation. Contact information is limited to a newsletter subscription form, with no direct emails or phone numbers listed. Overall, the website presents a moderate risk profile with good business credibility due to its government backing but requires improvements in technical security, privacy transparency, and modernization of its technology stack to enhance trust and compliance.

15
10
17
85
72
60
20
realestategovernmentpropertybulgariaforeignnationals+1 more
Joomla CMSjQuery 1.6MooToolsGoogle Analytics (ga.js)+1
2025-07-06T03:16:27.703Z
slotenmakerapeldoorn.com favicon

Slotenmaker Apeldoorn

slotenmakerapeldoorn.com

0
Real EstateNetherlandssmallHIGH

Slotenmaker Apeldoorn is a local locksmith service provider based in Apeldoorn, Netherlands, established in 2019. The company offers a range of locksmith services including emergency lock opening, lock replacement, burglary protection, and installation of advanced locking systems such as multi-point locks and core pull protection. The business positions itself as a fast, reliable, and certified locksmith service with multiple local locations ensuring rapid response times. The website reflects a professional and consistent brand image with clear contact details and customer trust signals such as high review ratings and SKG certification. Technically, the website is built on WordPress using the Elementor framework, hosted on SiteGround. It employs modern tracking tools like Google Analytics and Google Tag Manager, and implements a cookie consent mechanism indicating GDPR awareness. The site is mobile-optimized and SEO-friendly, though some accessibility features are basic. Security posture is moderate with HTTPS enabled but lacks advanced security headers and a published privacy policy or terms of service, which are compliance gaps. Overall, the security posture is adequate for a small local business but could be improved by implementing security headers, publishing privacy and terms documents, and enabling DNSSEC. No WAF or content blocking mechanisms were detected, and no vulnerabilities or suspicious patterns were found in the WHOIS data. The domain registration is consistent with the business claims and shows no signs of suspicious activity. Strategic recommendations include enhancing security headers, publishing comprehensive privacy and terms policies, adding a security.txt file for vulnerability disclosure, and continuing to maintain transparent and accessible contact information to strengthen trust and compliance.

15
50
17
70
62
65
-
locksmithapeldoornsecurityemergencyserviceskgcertified+3 more
WordPressElementorGoogle AnalyticsGoogle Tag Manager+1
2025-07-05T15:40:52.198Z
synvest.nl favicon

SynVest

synvest.nl

0
Real EstateNetherlandssmallMEDIUM

SynVest is a Dutch company specializing in real estate investment and real estate funds, targeting investors seeking higher returns in the property sector. The website presents a professional and consistent brand image with clear messaging focused on investment services and customer engagement through brochure requests and direct client onboarding. The domain is well-established since 2005, reinforcing business credibility. Technically, the website employs modern marketing and analytics technologies including Google Tag Manager, HubSpot, Hotjar, and Cookiebot for GDPR-compliant cookie consent management. The site is secured with HTTPS and DNSSEC, indicating a strong baseline security posture. However, there is room for improvement in implementing additional security headers and publishing explicit security policies. Security-wise, the site demonstrates good practices such as anti-CSRF cookies and comprehensive cookie consent mechanisms. No critical vulnerabilities or exposed sensitive data were detected. The absence of a terms of service page and incident response contact information suggests areas for legal and security policy enhancement. Overall, SynVest's website is a well-maintained, secure, and privacy-conscious platform suitable for its target audience. Strategic improvements in security headers, legal disclosures, and accessibility would further strengthen its trust and compliance posture.

15
88
2
80
82
70
100
realestateinvestmentvastgoedvastgoedfondsenbeleggen+2 more
JavaScriptGoogle Tag ManagerHubSpotHotjar+2
2025-07-05T15:40:37.117Z
S

ss.ge

ss.ge

0
Real EstateGeorgialargeMEDIUM

ss.ge is a leading Georgian online real estate classifieds platform offering a wide range of property listings including apartments, houses, commercial spaces, and land for sale or rent. It serves as a comprehensive marketplace connecting buyers, sellers, and renters across Georgia, with a strong focus on the local market. The platform provides additional services such as verified listings, promotional services, agent directories, and mortgage calculators, positioning itself as the largest real estate portal in the country. Technically, the website is built using modern web technologies including React and Next.js, supported by various third-party analytics and marketing tools such as Google Tag Manager, Microsoft Clarity, Facebook SDK, and Intercom. The site demonstrates good mobile optimization and SEO practices, ensuring accessibility and usability for a broad audience. Performance is moderate, with room for improvement in accessibility features. From a security perspective, the site enforces HTTPS and includes several important security headers, indicating a good baseline security posture. However, there is no explicit publication of security policies or incident response procedures, and no cookie consent mechanism is present, which impacts GDPR compliance. The WHOIS data is incomplete and lacks registrant details, which slightly reduces trustworthiness but does not negate the platform's legitimacy given its market presence and content quality. Overall, ss.ge presents a professional and functional real estate marketplace with solid technical infrastructure but could enhance its privacy compliance and transparency regarding security policies. Strategic improvements in these areas would strengthen user trust and regulatory adherence.

35
35
17
85
62
55
100
realestateclassifiedsgeorgiapropertyrent+1 more
ReactNext.jsGoogle Tag ManagerMicrosoft Clarity+3
2025-06-28T12:33:21.284Z
berstad-eiendom.no favicon

J Berstad Eiendom

berstad-eiendom.no

0
Real EstateNorwaymediumMEDIUM

J. Berstad Eiendom AS is a Norwegian real estate company specializing in the ownership, management, and sustainable development of commercial properties primarily in Bergen. Founded in 1996 and part of the Westfal-Larsen group, the company leverages over 100 years of experience in property management and sustainability. Their website reflects a professional and consistent brand image, targeting commercial tenants and businesses interested in sustainable real estate solutions. The company emphasizes active ownership, energy saving, waste sorting, and climate neutrality in their operations. Technically, the website is built on WordPress using Elementor and Yoast SEO, indicating a modern and maintainable infrastructure. The site is mobile-optimized and includes SEO best practices, though accessibility features are basic. Cookie consent is implemented with a detailed mechanism, supporting GDPR compliance. Google Analytics is used for visitor tracking with user consent. From a security perspective, the site uses HTTPS and cookie consent but lacks visible security headers and explicit security policies. No critical vulnerabilities or exposed sensitive data were detected. The domain registration is consistent with the business profile, enhancing trustworthiness. Overall, the website presents a solid digital presence with room for improvement in privacy policy publication, security headers, and accessibility enhancements. Strategic recommendations include adding comprehensive privacy and security policies, improving accessibility, and publishing vulnerability disclosure information to strengthen trust and compliance.

15
65
2
35
52
80
100
realestatepropertymanagementsustainabilitycommercialrealestatebergen+1 more
WordPressElementorYoast SEOjQuery+2
2025-06-27T21:13:15.638Z
g3enterprises.com favicon

G3 Enterprises

g3enterprises.com

0
Real EstateUnited StateslargeMEDIUM

G3 Enterprises is a large, established B2B company specializing in integrated supply chain solutions for the beverage, agriculture, and industrial real estate sectors. Their offerings include packaging, equipment, sand, labels, logistics, and real estate services. The company targets medium to large businesses in wine, spirits, beer, food, and agriculture industries, positioning itself as a trusted partner with a broad portfolio and strong industry presence. The website reflects a mature digital infrastructure built on Adobe Experience Manager, with modern web technologies and good mobile optimization. Security posture is strong with HTTPS, security headers, and reCAPTCHA protections, though explicit security policies and incident response contacts are not published. Privacy and cookie policies are present and GDPR compliant. The domain WHOIS data is missing, which raises some concerns about domain registration transparency, but the overall website professionalism and trust signals mitigate this risk. Strategic recommendations include publishing a security policy, incident response contacts, and vulnerability disclosure information to enhance trust and compliance.

55
35
17
75
82
80
100
industrialrealestatepackaginglogisticsbeverageindustrywine+4 more
Adobe Experience Manager (AEM)Google reCAPTCHAAdobe DTM/LaunchGoogle Maps API+1

Partner Domains:

collo-pack.com
subsidiary
diam-corks.com
subsidiary

+2 more partners

2025-06-27T18:59:00.591Z
blendproperty.co.za favicon

Blend Property Group

blendproperty.co.za

0
Real EstateSouth AfricamediumMEDIUM

Blend Property Group is a South African commercial property company established in 2006, specializing in property development, investment, and management across office, industrial, and retail sectors. With a portfolio valued around R2 billion and operations centered in major South African cities, the company offers in-house property management services to both its own assets and third-party clients. The website reflects a professional and consistent brand presence, providing clear contact details and business information. Technically, the website is built on WordPress using modern frameworks like Bootstrap and includes SEO and cookie consent plugins. The site is mobile-optimized and performs moderately well, though there is room for improvement in accessibility and security headers. The security posture is solid with HTTPS enforced and cookie consent implemented, but lacks advanced security headers and exposes some weak user interaction restrictions that may affect usability. WHOIS data is unavailable, likely due to privacy protection, which is common for commercial entities but reduces transparency. No WAF or blocking mechanisms were detected, allowing full content access. Privacy and cookie policies are present and GDPR compliant, supporting good privacy practices. Overall, the site is trustworthy and professional, with recommendations to enhance security headers, reconsider user interaction restrictions, and possibly add incident response contact information to strengthen security posture and compliance.

15
80
2
85
62
70
20
realestatepropertymanagementcommercialpropertysouthafricawordpress+3 more
WordPressBootstrapjQueryFlickity+5
2025-06-27T18:56:34.996Z
rentinriga.lv favicon

Rent In Riga

rentinriga.lv

0
Real EstateLatviamediumMEDIUM

RentInRiga.lv is a Latvian real estate platform specializing in rental, sale, and investment properties primarily in Riga and surrounding regions. The website offers a comprehensive property database with over 1250 listings including apartments, houses, offices, warehouses, and commercial spaces. The platform targets individuals and businesses seeking real estate solutions in Latvia, providing detailed search filters and property categories to facilitate user navigation and decision-making. The business model centers on online brokerage and property listing services, positioning itself as a key local player in the real estate market. Technically, the website employs a modern technology stack including jQuery, Select2, Flickity, Google Maps API, Bing Maps API, Leaflet, and various analytics and tracking tools such as Google Analytics, Facebook Pixel, and Hotjar. The site is mobile-optimized with good user experience and navigation clarity. However, some accessibility features are basic, and there is room for improvement in SEO and performance optimization. From a security perspective, the site enforces HTTPS and uses Google reCAPTCHA for form protection, indicating a baseline security posture. However, the absence of security headers and lack of explicit privacy and cookie policies reduce the overall security and compliance maturity. No vulnerabilities or exposed sensitive data were detected in the provided content. The WHOIS data is unavailable due to query limits, limiting domain trust verification, but the website content and contact information suggest legitimacy. Overall, RentInRiga.lv presents a professional and functional real estate platform with moderate technical and security maturity. Strategic improvements in privacy compliance, security headers, and incident response transparency would enhance trust and regulatory adherence.

15
10
2
85
75
75
100
realestatepropertyrentalpropertysaleinvestmentrental+2 more
jQueryjQuery UISelect2Flickity+9
2025-06-27T18:53:59.276Z
gelvorasergel.lv favicon

SIA GelvoraSergel

gelvorasergel.lv

0
Real EstateLatviasmallMEDIUM

SIA GelvoraSergel operates as a Latvian service provider specializing in debt recovery, reminder services, and real estate listings. The company targets Latvian individuals and businesses requiring financial recovery and property services, offering a client self-service portal for enhanced user experience. The website is multilingual, supporting Latvian, English, and Russian, reflecting a regional focus. The business appears small-sized, founded around 2014, with a consistent and professional online presence. Technically, the website is built on WordPress 6.5.3, utilizing modern plugins such as Yoast SEO and Cookiebot for privacy compliance. It integrates Google Tag Manager and reCAPTCHA for analytics and security. The site demonstrates moderate performance and good mobile optimization, though accessibility features are basic. Security best practices include HTTPS enforcement and form protection, but some security headers are not visibly implemented, suggesting room for improvement. From a security perspective, the site shows a mature posture with cookie consent mechanisms and secure form handling. No critical vulnerabilities or exposed sensitive data were detected in the HTML content. However, the absence of explicit security policies, incident response contacts, and vulnerability disclosure mechanisms indicates potential compliance gaps. WHOIS data was unavailable due to query limits, limiting domain legitimacy verification. Overall, the website is professional, trustworthy, and compliant with GDPR requirements, but could enhance security transparency and technical hardening. Strategic recommendations include implementing security headers, publishing security policies, and conducting regular vulnerability assessments to strengthen the security posture and trustworthiness.

30
83
2
65
42
80
100
debtrecoveryrealestatecookieconsentprivacypolicyclientportal+2 more
WordPress 6.5.3Yoast SEO pluginGoogle Tag ManagerGoogle reCAPTCHA v2+2
2025-06-27T18:53:34.119Z
linstowartaward.lv favicon

Linstow Art Award

linstowartaward.lv

0
Real EstateLatviasmallMEDIUM

The Linstow Art Award website represents a professional and well-structured platform dedicated to supporting young Latvian artists through an annual art award. The initiative is backed by Linstow Baltic, a leading real estate developer in the Baltics, in partnership with the Art Academy of Latvia. The site clearly communicates the award's mission, benefits, jury members, winners, and timeline, targeting emerging artists and the broader art community. The business model is non-profit and culturally focused, aiming to foster artistic growth and community engagement. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and CookieYes for consent management. It uses standard web technologies and libraries including jQuery, Axios, and intl-tel-input for enhanced user experience. The site is mobile-optimized, accessible, and SEO-friendly, with fast loading performance. Analytics are implemented via Google Analytics with appropriate cookie consent mechanisms. From a security perspective, the site enforces HTTPS and employs cookie consent banners to comply with privacy regulations. No critical vulnerabilities or exposed sensitive data were detected in the HTML content. However, security headers are not explicitly observed, and no incident response or vulnerability disclosure information is provided, which could be improved to enhance trust and security posture. Overall, the website presents a trustworthy and credible digital presence for the Linstow Art Award. The main limitation is the lack of WHOIS data due to query restrictions, which prevents full domain registration verification. Strategic recommendations include implementing security headers, publishing security policies, and adding vulnerability disclosure information to strengthen security and compliance further.

70
83
2
-
75
-
100
artawardlatviayoungartistsculture+3 more
WordPress 6.8.1Yoast SEO pluginCookieYes consent managementjQuery+3
2025-06-27T15:24:59.915Z
worldgbc.org favicon

World Green Building Council

worldgbc.org

0
Real EstateUnited StateslargeMEDIUM

World Green Building Council (WorldGBC) is a globally recognized non-profit organization established in 1999, dedicated to accelerating the sustainable and just transition of the built environment. It operates a large network of over 75 Green Building Councils and 70 partners worldwide, focusing on policy advocacy, sustainability frameworks, and fostering collaboration among governments, businesses, and communities. The organization targets stakeholders involved in real estate, energy, and environmental sustainability sectors. Technically, the website is built on WordPress with modern frameworks like Bootstrap 5 and integrates Google Maps API and various SEO and GDPR compliance plugins. Hosting is inferred to be on Amazon AWS infrastructure. The site demonstrates good mobile optimization, accessibility, and SEO practices, providing a professional and user-friendly experience. From a security perspective, the site uses HTTPS, Google reCAPTCHA v3, and GDPR cookie compliance mechanisms. However, DNSSEC is not enabled, and no explicit security or incident response policies are published. The WHOIS data confirms a long-standing and consistent domain registration, enhancing trustworthiness. Overall, the website is well-structured, content-rich, and professionally maintained, with minor areas for improvement in security policy transparency and DNS security. The risk profile is low, and the site effectively supports the organization's mission and stakeholder engagement.

15
95
25
87
52
80
100
sustainabilitygreenbuildingnon-profitenvironmentclimateaction+3 more
Bootstrap 5jQueryGoogle Maps APIYoast SEO+3
2025-06-27T14:23:53.648Z
G

Golden Properties Consulting

gpconsulting.lv

0
Real EstateLatviasmallHIGH

Golden Properties Consulting is a Latvian real estate consulting company specializing in property sales, rentals, and management services. The company targets buyers, sellers, and investors within Latvia, offering a range of residential and commercial properties. Their website provides property listings, search functionality, and multiple contact forms to facilitate client engagement. The company maintains an active social media presence and provides clear contact information, enhancing customer accessibility. Technically, the website employs a modern tech stack including Bootstrap, jQuery, Google reCAPTCHA v3, and Facebook Pixel for analytics and marketing. The site is mobile-optimized and features a cookie consent mechanism, indicating awareness of privacy compliance. However, no structured data or advanced SEO features were detected, and some accessibility features are basic. From a security perspective, the site uses HTTPS and protects forms with reCAPTCHA, but lacks visible security headers such as CSP or HSTS. The absence of explicit security or incident response policies and missing WHOIS data limit the ability to fully assess domain legitimacy and security posture. Overall, the site demonstrates moderate security maturity with room for improvement. The overall risk is moderate; the site is functional and professional but would benefit from enhanced security headers, clearer compliance documentation, and verified domain registration data. Strategic recommendations include implementing security headers, publishing detailed security and incident response policies, and ensuring WHOIS data availability to improve trust and compliance.

15
43
17
70
62
60
40
realestatepropertyconsultinglatviaresidential+4 more
jQueryBootstrapGoogle reCAPTCHA v3Facebook Pixel+3
2025-06-27T12:56:24.089Z