Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 172 of 177|Showing 8551-8600 of 8843
isleofmancreamery.com favicon

Isle of Man Creamery

isleofmancreamery.com

0
RetailIsle of ManmediumMEDIUM

Isle of Man Creamery is a well-established cooperative of family-owned dairy farms providing fresh, grass-fed dairy products including milk, cheese, cream, butter, and buttermilk to the Isle of Man community. The company emphasizes local sourcing and sustainability, with a strong market position as the leading dairy producer on the island. Their business model includes direct consumer sales supported by online ordering and doorstep delivery services. The website reflects a professional and consistent brand image with clear navigation and comprehensive legal and contact information. Technically, the website employs modern web technologies such as Bootstrap 5, jQuery, Swiper.js, and GSAP for a responsive and engaging user experience. Hosting appears to leverage AWS S3 for media assets, and Google Analytics is used for visitor tracking. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Performance is moderate, with room for optimization. From a security perspective, the site uses HTTPS and avoids exposing sensitive data. However, security headers are not explicitly detected, and Google reCAPTCHA is included but not fully configured. No critical vulnerabilities or suspicious elements were found. Privacy compliance is strong with clear privacy and cookie policies, though no explicit consent mechanism for cookies is present. Contact details are transparent and trustworthy. Overall, the website scores well on content quality, technical implementation, security posture, privacy compliance, and business credibility. There are no blocking mechanisms or WAF detected, and the domain registration data aligns well with the business claims, supporting legitimacy. Strategic improvements could focus on enhancing security headers, fully enabling CAPTCHA, and adding incident response information to further strengthen trust and compliance.

90
43
-
75
-
80
100
dairycreameryisleofmanmilkcheese+6 more
Bootstrap 5jQuerySwiper.jsGSAP+4
2025-06-18T08:07:08.760Z
yesss.co.uk favicon

YESSS Electrical

yesss.co.uk

0
RetailUnited KingdomlargeMEDIUM

YESSS Electrical is a prominent UK-wide electrical wholesaler and retailer, offering a vast range of over 10,000 electrical products sourced from leading UK brands. With a strong market presence supported by over 95 physical stores nationwide and an online platform, they cater to both trade professionals and public customers. Their services include technical assistance, free design services, next day delivery, and click & collect options, positioning them as a comprehensive supplier in the electrical industry. The company emphasizes competitive pricing and extensive product availability, reinforcing their position as a fast-growing leader in the UK electrical wholesale market. Technically, the website employs a modern technology stack including jQuery, Bootstrap, Google Tag Manager, Facebook Pixel, Google reCAPTCHA, and Visual Website Optimizer, ensuring a responsive and interactive user experience. The site is well-optimized for mobile devices and incorporates standard SEO and accessibility practices, though some accessibility features could be enhanced. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS, uses reCAPTCHA for form protection, and implements a cookie consent mechanism compliant with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security headers and a dedicated security policy or incident response page suggests areas for improvement in security posture. Overall, YESSS Electrical demonstrates a strong business and technical foundation with good compliance and security practices. Strategic enhancements in security headers, incident response transparency, and accessibility would further strengthen their risk management and user trust.

85
43
35
85
-
70
100
electricalsupplieswholesaleuktraderetail+5 more
jQuery 3.7.0Bootstrap 5.3.0Google Tag ManagerFacebook Pixel+4
2025-06-18T08:07:08.657Z
goal.at favicon

Alpine Brands GmbH & Co KG

goal.at

0
RetailAustriasmallHIGH

GOAL is an established Austrian beverage brand specializing in fruit-based refreshing drinks with reduced sugar content and added vitamins. The company targets consumers seeking healthier alternatives to traditional soft drinks, positioning itself as a trusted brand with a history dating back to 1929. The website effectively communicates product details, brand history, and contact information, supporting a positive market presence in retail and C&C sectors. Technically, the website is built on WordPress using the GeneratePress theme and Kadence Blocks, leveraging modern JavaScript libraries such as jQuery and Flickity for interactive elements. The site is mobile-optimized with good SEO practices and basic accessibility features. Performance is moderate, with room for improvement in loading speed and technical optimizations. From a security perspective, the site uses HTTPS with modern TLS protocols but lacks advanced security headers and features like HSTS and OCSP stapling. Cookie consent mechanisms are implemented in compliance with GDPR, and privacy policies are clearly presented. However, there is no visible incident response or vulnerability disclosure information, which could be enhanced to improve trust. Overall, the website presents a professional and trustworthy digital presence with minor technical and security improvements recommended to strengthen its posture and user trust.

15
18
25
50
72
85
20
fruitdrinksbeveragesrefreshingdrinksvitaminsreducedsugar+2 more
ApachejQueryFlickity carouselKadence Blocks+3
2025-06-16T16:23:23.782Z
gasteiner.at favicon

ALPINE BRANDS GmbH & Co KG

gasteiner.at

0
RetailAustriamediumHIGH

Gasteiner Mineralwasser, operated by ALPINE BRANDS GmbH & Co KG, is a well-established Austrian beverage brand specializing in pure alpine mineral water and natural fruit juice beverages. The company leverages its unique alpine origin and lifestyle branding, including event sponsorship such as the Infinity Music Tour, to engage its target audience. The website reflects a professional and consistent brand image with clear product offerings and active social media engagement. Technically, the website is built on a modern Drupal 11 CMS with PHP 8.3 backend, served via nginx and hosted on a PleskLin environment. It employs modern web technologies including Lottie animations and Swiper.js for interactive content. The site is mobile-optimized and performs well with fast load times and good SEO practices. From a security perspective, the site uses HTTPS with TLS 1.2 and 1.3 protocols and includes important security headers like X-Content-Type-Options and X-Frame-Options. However, it lacks HSTS and OCSP stapling, which are recommended for enhanced security. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong, with a clear cookie consent mechanism and a comprehensive privacy policy aligned with GDPR. Overall, the website demonstrates a solid security posture and business credibility with transparent WHOIS data matching the business identity. Strategic improvements in security headers and incident response disclosures could further enhance trust and compliance.

40
18
17
50
72
50
20
mineralwaterbeveragesnaturalalpinesustainability+2 more
PHP 8.3.22Drupal 11nginxLottie animations+2

Partner Domains:

infinitymusictour.at
partnerpending
2025-06-16T16:23:17.152Z
bettybarclay-group.com favicon

Betty Barclay

bettybarclay-group.com

0
RetailGermanylargeMEDIUM

Betty Barclay Group is a well-established fashion retail company specializing in exclusive women's clothing and managing multiple fashion brands. The website serves as a corporate portal presenting the group's brands, corporate information, and links to online shops and B2B services. The target audience primarily includes women interested in fashion and retail partners. The company maintains a strong market position in the retail sector in Germany with a large operational size. Technically, the website is built on a modern stack including PHP 8.2, Apache, and Shopware CMS, enhanced with various marketing and analytics tools such as Google Tag Manager, Econda, and 8select. The site demonstrates good performance, mobile optimization, and SEO practices, reflecting a mature digital infrastructure. From a security perspective, the site uses HTTPS with secure cookie attributes and no detected vulnerable cipher suites. However, it lacks HSTS and OCSP stapling, which are recommended for enhanced security. No critical vulnerabilities or exposed sensitive data were found. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR requirements. Overall, the website presents a professional, trustworthy, and secure digital presence with minor areas for improvement in security headers and accessibility. The domain registration and WHOIS data align well with the business claims, supporting legitimacy and trustworthiness.

15
43
17
50
77
50
40
fashionretailecommercewomensclothingbrandmanagement+4 more
PHP 8.2.26ApacheShopware (implied by URLs and scripts)JavaScript+6
2025-06-16T16:22:48.776Z
m3outlet.hu favicon

M3 PARK SERVICE Szolgáltató és Üzemeltető Korlátolt Felelősségű Társaság

m3outlet.hu

0
RetailHungarymediumCRITICAL

M3 Outlet is a retail outlet shopping center located in Polgár, Hungary, offering over 100 fashion brands with discounts ranging from 30% to 70%. The website targets regional shoppers interested in branded fashion products and provides multilingual support including Hungarian, English, Romanian, and Slovak. Key services include retail shopping, promotions, customer amenities such as free wifi, and tourism-related offerings like tax-free shopping. The business operates under M3 PARK SERVICE Kft., positioning itself as a significant regional outlet center with a medium-sized footprint. Technically, the website is built on Concrete CMS 9.3.2 and utilizes modern frontend technologies such as jQuery, Bootstrap 5, and Owl Carousel. Google Tag Manager is used for analytics and marketing tracking. However, the site lacks a valid SSL certificate and does not support HTTPS, which is a critical security deficiency. Performance data is missing, but inferred to be slow. Mobile optimization and SEO are good, but accessibility is basic. Security posture is weak due to the absence of HTTPS, lack of HSTS, and missing advanced security headers. No explicit privacy or cookie consent mechanisms are implemented, and no security or incident response policies are visible. Contact information is clearly provided, enhancing business credibility. Overall, the site is functional and professionally designed but requires urgent security improvements, especially SSL/TLS configuration, to protect user data and improve trust. Implementing privacy compliance features and enhancing security headers would further strengthen the security posture.

30
-
25
50
-
50
-
retailoutletfashionshoppinghungary+3 more
jQueryBootstrap 5Owl CarouselGoogle Tag Manager+1

Partner Domains:

cmdesign.hu
partnerpending
2025-06-16T16:08:14.267Z
adaro.net favicon

Adaro Optics Ltd.

adaro.net

0
RetailN/asmallMEDIUM

Adaro Optics Ltd. operates a specialized platform focused on optical subscription technology, targeting both optical retailers and end customers. Their flagship platform, Adaro Direct, enables retailers to offer subscription and payment solutions for eyewear, eyecare, and audiology products, aiming to increase customer loyalty and revenue. The company is positioned as a niche provider within the retail optical sector, trusted by major industry players such as Specsavers and Vision Express. The website reflects a professional and consistent brand image with good content quality and clear navigation. Technically, the website leverages modern frameworks including Blazor and Bootstrap 5, with integration of Google services for analytics and bot protection. Hosting assets on Microsoft Azure Blob Storage indicates a reliable infrastructure. While the site is mobile-optimized and performs moderately well, there is room for improvement in accessibility and SEO optimization. The absence of a CMS suggests a custom or framework-based solution. From a security perspective, the site uses HTTPS and Google reCAPTCHA, but lacks visible security headers and a published security policy or incident response contacts. The presence of ISO 27001 certification is a strong trust indicator, though explicit privacy policy documentation is missing, which is a compliance gap. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a trustworthy and credible business with a solid technical foundation. Strategic improvements in privacy compliance, security headers, and accessibility would enhance the security posture and regulatory adherence, supporting long-term business growth and customer trust.

45
10
5
70
-
75
100
opticalsubscriptioneyewearretailtechnology+2 more
BlazorBootstrap 5Google FontsGoogle Tag Manager+1

Partner Domains:

adarodirect.com
partner
2025-06-15T22:28:32.804Z
H

Huber Holding AG

huberholding.com

0
RetailAustriamediumMEDIUM

Huber Holding AG is a well-established Austrian company specializing in the production and distribution of high-quality underwear and lingerie brands such as HANRO, HUBER, and SKINY. Founded in 1908, the company has a long-standing presence in the retail and manufacturing sectors, targeting adult consumers with premium bodywear products. The website content is minimal and primarily serves as a frameset container pointing to another page, with metadata describing the business but lacking substantive content or interactive features. Technically, the website is built using outdated technology, specifically Microsoft FrontPage 5.0 and framesets, which are no longer considered modern or mobile-friendly. There is no evidence of modern CMS, analytics, or tracking tools, and the site lacks mobile optimization and accessibility features. Performance is likely slow due to legacy design choices, and SEO optimization is basic, relying mostly on meta tags. From a security perspective, the site does not demonstrate modern security best practices. There is no indication of HTTPS enforcement or SSL certificates in the provided data, no security headers, and no privacy or cookie policies to comply with GDPR. No contact information or incident response channels are visible, which limits transparency and user trust. These factors contribute to a low security posture and compliance level. Overall, the website presents a moderate business credibility due to the company's established history and consistent WHOIS data, but the digital presence is weak and outdated. The lack of security and privacy measures, combined with poor technical implementation, poses risks to user trust and regulatory compliance. Strategic improvements in security, privacy, and modernization of the website are recommended to enhance the company's digital maturity and customer confidence.

15
25
5
80
-
70
100
unterwschedessoushanrohuberskiny+3 more
Microsoft FrontPage 5.0
2025-06-15T22:27:15.322Z
orderman.com favicon

Orderman GmbH

orderman.com

0
RetailAustriamediumLOW

Orderman GmbH is a well-established company specializing in professional hardware and services tailored for the hospitality and retail sectors. With over 30 years of experience and a strong market position as a leader in mobile cash registers, Orderman offers a broad portfolio including handheld devices, POS systems, printers, panel PCs, kiosks, and call systems. The company operates primarily in Austria and Italy, with additional presence in Dubai, and is a subsidiary of NCR, enhancing its credibility and market reach. The website reflects a mature digital presence with comprehensive content, clear navigation, and strong branding consistency. Technically, the website is built on WordPress using modern frameworks such as Elementor and JetEngine, supported by Borlabs Cookie for GDPR-compliant cookie management. It integrates Google Tag Manager and Google Analytics with consent mode enabled, demonstrating a good level of digital maturity and privacy awareness. The site is mobile-optimized and performs moderately well, with good SEO practices and accessibility features. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes standard security headers. It employs cookie consent mechanisms and avoids exposing sensitive data. However, it lacks a dedicated security policy or incident response page, and no vulnerability disclosure or security.txt file is present. These gaps represent opportunities for improving transparency and security posture. Overall, Orderman GmbH's website is professional, trustworthy, and compliant with privacy regulations, supporting its business credibility. Strategic enhancements in security policy communication and incident response readiness would further strengthen its risk management and customer trust.

15
25
-
75
-
65
-
ordermanhospitalityretailposhandhelds+3 more
WordPressElementorJetEngineBorlabs Cookie+4

Partner Domains:

partner.orderman.com
partner
rma.orderman.com
service
2025-06-15T22:26:23.535Z
wmf.com favicon

Groupe SEB WMF Retail GmbH

wmf.com

0
RetailGermanylargeHIGH

WMF Onlineshop is the official e-commerce platform of Groupe SEB WMF Retail GmbH, a historic German company with over 170 years of tradition in premium kitchenware and coffee machines. The website offers a comprehensive product catalog, including cutlery, pots, pans, coffee machines, and kitchen accessories, targeting consumers seeking high-quality kitchen products. The platform integrates modern technologies such as Magento 2 with Hyvä Theme, Alpine.js, and various marketing and analytics tools, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS and employs monitoring tools like New Relic. It also implements robust privacy and cookie consent mechanisms via OneTrust, ensuring GDPR compliance. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not visibly configured, representing an area for improvement. No critical vulnerabilities or WAF blocking were detected, indicating a secure and accessible platform. Overall, WMF Onlineshop demonstrates a high level of professionalism, technical sophistication, and compliance with privacy regulations. It effectively balances user experience, security, and business needs, positioning itself as a trustworthy and reputable online retailer in the premium kitchenware market.

85
63
-
85
-
85
100
e-commerceretailkitchenwareprivacycookieconsent+3 more
JavaScriptAlpine.jsGlider.jsGoogle Tag Manager+4

Partner Domains:

aboutwmf.com
partner
www.schaerer.com
partner

+3 more partners

2025-06-15T22:26:22.465Z
leifheit.com favicon

Leifheit

leifheit.com

0
RetailGermanylargeHIGH

Leifheit is a well-established German retail company specializing in household and kitchen products, with a strong brand presence and a history of over 65 years. The website serves as an e-commerce platform built on Shopware 6, offering a wide range of products including cleaning tools, laundry drying solutions, and kitchen utensils. The site is professionally designed with good navigation, mobile optimization, and rich multimedia content, targeting household consumers seeking quality products. Technically, the site uses modern JavaScript libraries and integrates marketing and analytics tools such as Bazaarvoice, Klaviyo, and Google Tag Manager. However, a critical security gap exists as the website currently lacks a valid SSL/TLS certificate and does not enforce HTTPS, exposing users to potential risks. Security headers are partially implemented, but the absence of HTTPS severely impacts the overall security posture. Privacy and cookie policies are present and include consent mechanisms, indicating compliance with GDPR requirements. Contact information is available via a contact page, though no explicit emails or phone numbers are embedded in the HTML content. The domain registration and DNS records are consistent with the company's German origin and business claims, supporting legitimacy. Strategic recommendations include immediate implementation of HTTPS, enhancement of security policies, and improved incident response readiness to strengthen trust and compliance.

-
15
-
50
-
85
100
e-commercehouseholdcleaningkitchenretail+1 more
Shopware 6Swiper.jsBazaarvoiceCookiebot+4

Partner Domains:

leifheit-group.com
parentpending
e-point.pl
partner96
2025-06-15T22:12:07.254Z
musicdirect.com favicon

Music Direct

musicdirect.com

0
RetailUnited StatesmediumHIGH

Music Direct operates as a specialized e-commerce retailer focusing on high-end audio equipment and audiophile music products, including vinyl records and turntables. The company positions itself as a leading online destination for audiophiles and music enthusiasts, offering a broad catalog of equipment and music media. Their business model centers on direct online sales, supported by customer service, trade-in programs, and financing options. The website reflects a mature digital presence with comprehensive product offerings and clear navigation tailored to their target audience. Technically, the website is built on the BigCommerce platform using the Stencil framework, leveraging modern web technologies such as jQuery, Bootstrap, and OwlCarousel. The site integrates multiple marketing and analytics tools including Google Analytics 4, Klaviyo, Lucky Orange, and Yotpo, indicating a sophisticated approach to customer engagement and data-driven marketing. Hosting is provided via Cloudflare, enhancing performance and availability. From a security perspective, the site exhibits significant weaknesses. Despite Cloudflare hosting, the SSL certificate is invalid or missing, and no TLS protocols are enabled, resulting in unencrypted HTTP traffic. Security headers such as X-Frame-Options and X-Content-Type-Options are present, but critical HTTPS enforcement and HSTS configurations are lacking. These deficiencies expose the site and its users to potential interception and downgrade attacks. Privacy and cookie policies are well implemented with consent mechanisms, reflecting compliance with GDPR and related regulations. Overall, while the business and technical infrastructure are solid and professional, the lack of proper SSL/TLS configuration is a critical security gap that undermines user trust and data protection. Addressing this issue should be a top priority to ensure secure transactions and compliance with industry standards.

-
-
5
50
-
90
100
e-commerceaudiovinylmusicretail+1 more
jQuery 3.6.0BigCommerce Stencil frameworkBootstrap 5.3.3OwlCarousel 2.3.4+7
2025-06-15T22:12:00.331Z
B

Burger King

bk.com

0
RetailN/aenterpriseHIGH

Burger King's website at bk.com presents a minimalistic digital presence primarily built using modern web technologies such as React Native Web and Expo Router, hosted on AWS infrastructure with CloudFront CDN. The site includes a cookie consent mechanism via OneTrust, indicating some level of privacy compliance effort. However, the website lacks visible content such as privacy policies, terms of service, or contact information, which limits user trust and transparency. From a security perspective, the site is undermined by the absence of a valid SSL certificate and HTTPS support, exposing users to potential risks. While security headers are properly configured, the lack of encryption and presence of a subdomain takeover vulnerability on dev.bk.com represent significant security concerns. The DNS and WHOIS data indicate legitimate domain registration consistent with the brand, but the subdomain issue requires urgent remediation. Overall, the website's technical infrastructure is modern but incomplete in critical areas such as security and content completeness. The lack of essential legal and contact information, combined with security vulnerabilities, results in a moderate to low trust level. Strategic improvements in SSL deployment, vulnerability mitigation, and content enrichment are necessary to enhance security posture and user confidence.

-
-
-
50
-
65
100
fastfoodburgerrestaurantreact-native-webexpo-router+3 more
React Native WebExpo RouterAmazon S3CloudFront+3
2025-06-15T22:11:08.287Z