Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 59 of 870|Showing 2901-2950 of 43489
demokratie-leben-hanau.de favicon

Magistrat der Stadt Hanau

demokratie-leben-hanau.de

0
GovernmentGermanysmallHIGH

The website www.demokratie-leben-hanau.de represents a government-affiliated non-profit partnership focused on promoting democracy, diversity, and tolerance in Hanau, Germany. It serves as a platform to coordinate local civil society actors, government bodies, and political stakeholders to foster community engagement and support projects aligned with these values. The site provides comprehensive information on funding opportunities, ongoing projects, events, and contact details, reflecting a well-structured and community-oriented business model. Technically, the website is built on Joomla CMS with modern frontend technologies such as Bootstrap 5 and jQuery, ensuring responsive design and moderate performance. Hosting is provided by SchlundTech, a reputable German hosting provider. The site employs HTTPS with a valid SSL configuration and includes CSRF tokens in forms, indicating attention to security best practices. However, some HTTP security headers appear to be missing, which could be improved. From a security and compliance perspective, the site demonstrates good GDPR compliance with clear privacy and cookie policies and consent mechanisms. Contact information is transparent and professional, but there is no explicit security policy or incident response information available. No vulnerabilities or suspicious content were detected, and the site maintains a safe content rating suitable for general audiences. Overall, the website is trustworthy, professionally maintained, and fulfills its role as a local government and civil society communication platform. Strategic recommendations include enhancing security headers, adding explicit security policies, and maintaining up-to-date software to further strengthen its security posture.

30
68
17
70
72
45
-
demokratiehanaudiversitynon-profitgovernment+3 more
Joomla CMSBootstrap 5.3.8jQuery 3.7.1Awesomplete+1

Partner Domains:

demokratie-leben.de
partner
hdv-hanau.de
partner

+3 more partners

2025-10-29T06:07:16.923Z
penta-tec.com favicon

Penta-Tec

penta-tec.com

0
ManufacturingAustriasmallHIGH

Penta-Tec is a specialized provider of CNC control software and hardware solutions, offering an all-in-one CAD, CAM, and CNC machine operation package tailored for machine and plant builders in the CNC sector. The company targets both beginners and professionals, emphasizing flexibility and ease of use. Their market position is that of a niche player with over 25 years of expertise, providing customized solutions that balance standardization and individualization. The website reflects a professional and consistent brand image with clear contact information and GDPR-compliant privacy practices. Technically, the website is built on WordPress with a modern theme and plugins, including Yoast SEO and Google Analytics integration with IP anonymization. The site is mobile-optimized and performs moderately well, though some accessibility features could be improved. Security-wise, HTTPS is enforced, and basic best practices are followed, but explicit security headers and incident response information are lacking. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is missing or indicates the domain may not be registered, which raises concerns about domain legitimacy despite the professional website presence. No WAF or blocking mechanisms are detected, and the site content is safe for general audiences. Overall, the website scores well in content quality and privacy compliance but is penalized for missing WHOIS data and incomplete security disclosures. Strategic recommendations include verifying domain registration, enhancing security headers, publishing incident response and vulnerability disclosure policies, and improving accessibility compliance to strengthen trust and security posture.

15
83
2
70
62
60
20
cnccadcamsteuerungmaschinenbau+5 more
WordPress 6.8.3Enfold Theme 7.1Yoast SEO pluginGoogle Analytics+5
2025-10-29T06:07:06.827Z
landwirtschaftmachtschule.de favicon

i.m.a - information.medien.agrar e.V.

landwirtschaftmachtschule.de

0
EducationGermanysmallHIGH

The website 'Landwirtschaft macht Schule' is an initiative by i.m.a - information.medien.agrar e.V. aimed at integrating agriculture into school education in Germany. It connects farmers with schools to provide practical and sustainable learning experiences, promoting awareness of regional food production and agricultural practices. The platform offers resources, training, and a network for teachers, farmers, and associations, positioning itself as a niche educational non-profit with a strong focus on sustainability and hands-on learning. Technically, the website is built on the MYOB CMS platform using modern frameworks such as UIkit and jQuery. It features responsive design, good navigation, and moderate performance. The site employs HTTPS with a cookie consent mechanism, ensuring GDPR compliance. However, it lacks some advanced security headers and explicit incident response or vulnerability disclosure information. From a security perspective, the site demonstrates good practices with no detected vulnerabilities or exposed sensitive data. The absence of tracking scripts and minimal user data collection aligns with privacy best practices. The WHOIS data is limited but consistent with the site's professional and educational nature, showing no suspicious patterns. Overall, the website is trustworthy, well-structured, and serves its educational mission effectively. Strategic improvements in security headers, accessibility, and transparency regarding security policies could further enhance its posture and user trust.

35
43
17
70
72
60
-
agricultureeducationsustainabilitynon-profitgerman+3 more
jQueryUIkitYoothemeMYOB CMS
2025-10-29T05:56:32.064Z
A

Amt für Gemeindedienst

ehrenamt-evangelisch-engagiert.de

0
Non-profitGermanysmallHIGH

The website 'Ehrenamt Evangelisch Engagiert' serves as an informational and community platform supporting voluntary engagement within the Evangelical Lutheran Church in Bavaria. It provides news, resources, and coordination services for volunteers and church members, positioning itself as a niche non-profit entity focused on church-related volunteerism. The site is professionally designed with consistent branding and clear navigation, targeting German-speaking church volunteers and coordinators. Technically, the site is built on TYPO3 CMS with modern JavaScript libraries such as Leaflet for maps and Matomo for privacy-conscious analytics. The site is mobile-optimized and performs moderately well, with basic accessibility features. Security posture is solid with HTTPS enforced and minimal cookies used, although security headers are not explicitly detected. Privacy compliance is good, with a clear cookie banner and privacy policy in German. No critical vulnerabilities or blocking mechanisms were detected. The WHOIS data aligns with the website's organizational claims, showing consistent domain registration and DNS management. Contact information is transparent and professional, including official church email and phone numbers. Social media presence is limited to Facebook. Overall, the website demonstrates a mature digital presence for a small non-profit church entity, with good security and privacy practices but room for improvement in security headers and incident response disclosures.

40
43
2
70
62
60
20
ehrenamtevangelischkirchefreiwilligenarbeitnon-profit+4 more
TYPO3 CMSLeaflet.jsMatomo AnalyticsjQuery+2
2025-10-29T05:55:06.883Z
V

Vogel Software GmbH

vogel-software.de

0
TechnologyGermanysmallHIGH

Vogel Software GmbH is a small, established German software company specializing in custom software development, particularly in Warenwirtschaft (inventory management) and Produktionsplanung (production planning) systems using Visual FoxPro and .NET technologies. Founded in 1989, the company offers tailored software solutions, coaching, and porting services, targeting SMEs in various sectors including trade, industry, and engineering firms. Their flagship products include vmAuftrag and the StarLib C# framework. The website reflects a professional and consistent brand image with detailed business and contact information, supporting their market credibility. Technically, the website employs modern web technologies such as Bootstrap, jQuery, and Google reCAPTCHA for form security. Hosting is managed via nshost2.de name servers, and the site includes analytics via Piwik. While the site is mobile-optimized and SEO-friendly, some security best practices like security headers (CSP, HSTS) are missing, and no cookie consent mechanism is implemented despite cookie usage. From a security perspective, the site uses HTTPS and protects its contact form with reCAPTCHA, but lacks explicit security policies and incident response information. The WHOIS data confirms the domain's legitimacy and long-standing registration consistent with the company's history. Overall, the site is trustworthy, safe, and professionally maintained, though improvements in security headers and privacy compliance could enhance its posture. The risk level is low, with no signs of malicious content or blocking mechanisms. Strategic recommendations include implementing security headers, adding cookie consent, and publishing security policies to strengthen compliance and trust.

15
28
2
80
67
70
-
softwareentwicklungwarenwirtschaftproduktionsplanungindividualsoftwarecoaching+3 more
HTML5CSS3BootstrapjQuery+6
2025-10-29T05:55:01.870Z
G

Gemeindewerke Kahl Versorgungsgesellschaft mbH

gemeindewerke-kahl.de

0
EnergyGermanysmallHIGH

Gemeindewerke Kahl Versorgungsgesellschaft mbH is a regional utility provider based in Kahl am Main, Germany, offering electricity, gas, and water supply services. The company emphasizes sustainable energy solutions, including 100% certified hydropower electricity and climate-neutral gas options. Their market position is that of a trusted local supplier with a focus on environmental responsibility and customer service. The website targets residential and commercial customers in the region, providing online contract management, energy-saving tips, and services related to electromobility and photovoltaics. Technically, the website is built using modern web technologies including Bootstrap 5 and jQuery, hosted on rzone.de servers. It is mobile-optimized with good accessibility and SEO practices. The site includes interactive elements such as a tariff calculator form and a well-structured navigation menu. However, no CMS or advanced platform is explicitly detected. From a security perspective, the site uses HTTPS and secure form inputs but lacks visible security headers and explicit incident response or vulnerability disclosure policies. No cookie consent mechanism was detected, which may pose GDPR compliance risks. The WHOIS data is consistent with the website content and business legitimacy, with no suspicious patterns. Overall, the website is professional, trustworthy, and well-suited for its business purpose. Strategic improvements in security headers, privacy compliance, and incident response transparency would enhance its security posture and regulatory adherence.

25
28
2
60
77
60
20
energyutilityregionalelectricitygas+3 more
HTML5CSS3Bootstrap 5jQuery 3.6.4+1
2025-10-29T05:54:06.738Z
E

Elektrizitätswerk Goldbach-Hösbach GmbH & Co. KG

ew-goldbach-hoesbach.de

0
EnergyGermanymediumHIGH

Elektrizitätswerk Goldbach-Hösbach GmbH & Co. KG is a regional utility and telecommunications provider serving the Goldbach and Hösbach areas in Germany. The company offers a range of services including electricity, natural gas, water supply, and telecommunications such as VDSL and Glasfaser internet. Their website reflects a medium-sized enterprise with a professional online presence, targeting both residential and business customers. The content is well-organized, informative, and tailored to the local market, emphasizing energy solutions, e-mobility, and building management services. Technically, the website employs a modern tech stack including jQuery, Bootstrap, and Blueimp Gallery, ensuring good mobile optimization and accessibility. The site uses HTTPS and implements cookie consent mechanisms in line with GDPR requirements. Google Analytics is used for visitor tracking with an opt-out option, indicating moderate user tracking. However, no CMS or hosting provider information is explicitly identified. From a security perspective, the site shows basic best practices such as HTTPS and cookie consent but lacks visible security headers, a published security policy, or incident response contacts. No vulnerability disclosure or security.txt file is present. The WHOIS data is limited but does not raise immediate concerns. Overall, the security posture is moderate with room for improvement in transparency and technical security controls. The website is safe for general audiences, with no adult or questionable content detected. The business credibility is high given the clear contact information, professional design, and consistent branding. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and maintaining up-to-date third-party libraries to strengthen the security posture and compliance.

50
28
2
70
62
70
-
energytelecommunicationswaterregionalutilitygdpr+4 more
jQuery 3.4.1Bootstrap 4 (bootstrap.bundle.min.js)Blueimp Gallery 2.36.0js.cookie+1
2025-10-29T05:53:51.691Z
shk-aschaffenburg.de favicon

SHK Innung Aschaffenburg–Miltenberg

shk-aschaffenburg.de

0
OtherGermanysmallHIGH

SHK Innung Aschaffenburg–Miltenberg operates as a regional professional guild specializing in sanitary, heating, and air conditioning services within the Aschaffenburg and Miltenberg regions of Germany. The website serves as an information portal and member resource, providing industry news, contact details, and regulatory compliance information. The business model focuses on supporting local professionals and companies in the sector, positioning itself as a trusted regional association. Technically, the website is built on WordPress, utilizing common plugins such as Real Cookie Banner for privacy compliance and Bold Page Builder for content management. The site is hosted via DomainControl (GoDaddy), employs HTTPS, and demonstrates moderate performance with good mobile optimization. SEO and accessibility are adequately addressed, though some improvements in security headers could enhance the technical posture. From a security perspective, the website enforces HTTPS and includes a cookie consent mechanism aligned with GDPR requirements. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of a dedicated security policy or incident response information suggests room for maturity in security governance. Overall, the site maintains a good security posture suitable for its business scope. The overall risk assessment indicates a low risk profile with strong compliance and trust indicators. Strategic recommendations include enhancing security headers, formalizing incident response procedures, and maintaining regular updates to WordPress and plugins to mitigate potential vulnerabilities.

15
60
17
60
77
60
20
sanitaryheatingairconditioningprofessionalguildgermany+3 more
WordPressPHPjQueryReal Cookie Banner plugin+1
2025-10-29T05:53:21.610Z
ze-energy.net favicon

株式会社ZEエナジー

ze-energy.net

0
EnergyJapansmallHIGH

株式会社ZEエナジー is a Japanese company specializing in biomass energy solutions aimed at achieving a sustainable society. Their core business involves developing and operating biomass power generation systems that convert waste and thinning wood into energy through carbonization and gasification processes. The company positions itself as an environmental consulting group focused on renewable energy and waste management, targeting enterprises and government bodies concerned with environmental issues. Their product lineup includes various biomass gasification and carbonization devices, supported by consulting and service offerings. The website is professionally designed, bilingual (Japanese and English), and provides comprehensive company and contact information, reflecting a credible and established business presence since 2011. Technically, the website is built on WordPress CMS, utilizing modern libraries such as jQuery, Bootstrap 5, Slick Carousel, and Font Awesome 6. It employs Google Analytics for user tracking and is hosted under a registrar known for domain services in Japan. The site is mobile-optimized with good SEO practices but lacks some advanced accessibility features. Performance is moderate, with no critical technical debt observed. From a security perspective, the site uses HTTPS with a valid SSL certificate, ensuring encrypted communications. However, it lacks DNSSEC and security headers like Content-Security-Policy or X-Frame-Options, which are recommended for enhanced protection. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is partial; a privacy policy is present, but no cookie consent mechanism or GDPR-specific indicators were found. Incident response contacts and vulnerability disclosure policies are absent, representing areas for improvement. Overall, the website demonstrates a solid business credibility and technical foundation with room for security and privacy enhancements. The risk profile is low, with no signs of malicious activity or content safety concerns. Strategic recommendations include implementing DNSSEC, adding security headers, deploying cookie consent tools, and publishing incident response information to strengthen trust and compliance.

15
53
2
70
72
60
20
energybiomassenvironmentsustainabilityrenewableenergy+2 more
jQueryBootstrap 5Slick CarouselLightbox2+2
2025-10-29T05:52:56.540Z
menzel-metallchemie.de favicon

Menzel Metallchemie GmbH

menzel-metallchemie.de

0
ManufacturingGermanymediumHIGH

Menzel Metallchemie GmbH is a German-based medium-sized company specializing in the development and manufacturing of minimum quantity cooling and lubrication technologies using biodegradable high-performance oils. Positioned as a pioneer and market leader, the company serves industrial manufacturers, particularly in metal and plastic processing sectors, offering products such as spray technology systems, cooling lubricants, safety cold bronzing systems, and technical cleaning solutions. The website reflects a professional and consistent brand image with comprehensive product information and multiple contact channels including GDPR-compliant forms. Technically, the website is built on Mae CMS and employs modern web technologies including HTML5, CSS, JavaScript, and jQuery, with Matomo analytics for privacy-conscious user tracking. The site is mobile-optimized with good SEO practices, though some accessibility features are basic. Performance is moderate, with room for improvement in loading speed and security headers. From a security perspective, the site uses HTTPS with good SSL configuration and secure forms incorporating CSRF tokens and GDPR consent checkboxes. However, explicit security policies and incident response information are absent, and security headers are not detected. No vulnerabilities or suspicious content were found, indicating a generally sound security posture. Overall, the website is trustworthy and professional, with strong business credibility and compliance with privacy regulations. Recommendations include implementing cookie consent mechanisms, enhancing security headers, and publishing security and incident response policies to further strengthen trust and compliance.

20
28
2
75
72
65
20
manufacturingcoolinglubricantsspraytechnologyindustrialcleaningbiodegradableoils+1 more
HTML5CSSJavaScriptjQuery+2
2025-10-29T05:50:11.139Z
markgrafenkirchen-ansbach.de favicon

Markgrafenkirchen im Markgraftum Ansbach

markgrafenkirchen-ansbach.de

0
GovernmentGermanysmallHIGH

The website www.markgrafenkirchen-ansbach.de serves as an informational platform dedicated to the Markgrafenkirchen churches located in the Markgraftum Ansbach region of Germany. It provides visitors with historical, architectural, and cultural insights about these churches, supported by interactive maps, directories, and downloadable brochures. The site targets tourists, local community members, and cultural heritage enthusiasts. It is supported and financed by regional church organizations, reflecting a niche cultural heritage focus within the government/non-profit sector. Technically, the site is built on Drupal 10 CMS, employing modern web technologies including the Klaro consent manager for GDPR compliance and jQuery Colorbox for image galleries. Hosting is provided by kunde24.de, a typical hosting provider for small to medium German websites. The site demonstrates good mobile optimization, accessibility, and SEO practices, with a clean and professional design. From a security perspective, the site uses HTTPS (assumed though not explicitly confirmed in headers), employs a cookie consent mechanism, and does not expose sensitive data or vulnerable libraries in the HTML content. However, explicit HTTP security headers are not detected, and no dedicated security or incident response policies are published. Privacy compliance is well addressed with a clear privacy policy and cookie consent. No analytics or tracking beyond consent management is observed, indicating a privacy-conscious approach. Overall, the website presents a low-risk profile with a good balance of content quality, technical implementation, and privacy compliance. It is suitable for its cultural heritage mission but could improve security posture by adding security headers and explicit policies. Contact information is limited to a contact form, which may impact direct communication channels.

40
28
2
60
62
60
20
culturalheritagechurchesmarkgrafenkirchenansbachdrupal+2 more
Drupal 10Klaro Consent ManagerjQuery Colorbox
2025-10-29T05:49:51.073Z
guss.de favicon

BDG – Bundesverband der Deutschen Gießerei-Industrie

guss.de

0
ManufacturingGermanymediumHIGH

The website www.guss.de represents the BDG – Bundesverband der Deutschen Gießerei-Industrie, a prominent German foundry industry association. It serves as an information hub for industry news, events, research projects, and training related to the foundry sector. The site targets professionals, researchers, and stakeholders within the German manufacturing and foundry industry. The business model is centered on advocacy, knowledge dissemination, and member services, positioning BDG as a key industry player in Germany. Technically, the website is built on TYPO3 CMS, a robust and widely used content management system, and integrates modern tools such as Google Tag Manager, Google Analytics, and Usercentrics for consent management. Hosting is provided by Intersolute, as indicated by the domain's nameservers. The site demonstrates good mobile optimization and SEO practices, though accessibility features are basic. Performance is moderate, with a professional and consistent design. From a security perspective, the site enforces HTTPS and uses consent management for cookies, reflecting GDPR awareness. However, no explicit privacy policy or terms of service pages were found in the provided content, and no security headers were detected, suggesting room for improvement in security hardening. No vulnerabilities or exposed sensitive data were identified. The WHOIS data aligns well with the website content, indicating a legitimate and trustworthy domain registration. Overall, the website is professional, content-rich, and trustworthy, but could enhance its privacy and security posture by publishing clear policies, adding security headers, and providing contact information for incident response. These improvements would strengthen compliance and user trust.

-
28
17
70
62
60
40
foundryindustrygussgussindustriebdg+3 more
TYPO3 CMSGoogle Tag ManagerGoogle AnalyticsUsercentrics Consent Management+2

Partner Domains:

extranet.bdguss.de
partner
wer-giesst-was.de
partner

+3 more partners

2025-10-29T05:49:10.963Z