Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 59 of 65|Showing 2901-2950 of 3226
education.gov.uk favicon

Department for Education

education.gov.uk

0
GovernmentUnited KingdomenterpriseMEDIUM

The Department for Education (DfE) is a UK government ministerial department responsible for children’s services and education policy across England, including early years, schools, higher and further education, apprenticeships, and wider skills development. It operates at an enterprise scale with a broad portfolio of 17 agencies and public bodies supporting its mission. The website serves a diverse audience including educators, parents, policymakers, and the general public, providing statutory guidance, data, and services related to education. Technically, the website is built on the GOV.UK platform using modern web technologies such as JavaScript modules, the GOV.UK Design System, and Google Analytics 4 for performance and user behavior tracking. It demonstrates excellent mobile optimization, accessibility, and SEO practices, ensuring a professional and user-friendly experience. The site is hosted and maintained by the UK Government Digital Service, ensuring robust infrastructure and fast performance. From a security perspective, the site enforces HTTPS, employs security best practices including secure forms with anti-spam measures, and provides a cookie consent mechanism aligned with privacy regulations. No vulnerabilities or exposed sensitive data were detected. However, explicit security policies and incident response information are not publicly detailed, representing an area for improvement. Overall, the website reflects a high level of professionalism, trustworthiness, and compliance with privacy and accessibility standards. It is a critical digital asset for the UK government’s education sector, supporting transparency and public engagement.

70
58
5
98
-
70
100
educationgovernmentchildrenservicesschoolsapprenticeships+2 more
JavaScript modulesgovuk_publishing_componentsLux (performance measurement)GA4 (Google Analytics 4)+1
2025-06-21T18:21:55.285Z
starlimited.co.uk favicon

ST&R Limited

starlimited.co.uk

0
FinanceUnited KingdomsmallHIGH

ST&R Limited is a UK-based independent insurance broker authorized by the Financial Conduct Authority (FCA). The company offers a range of insurance products including life, home, health, critical illness, income protection, and specialized policies for over 45s. Positioned as a customer-centric broker, ST&R emphasizes personalized advice and competitive insurance solutions. The website reflects a professional and consistent brand image with clear navigation and relevant content targeting individuals and businesses seeking insurance coverage in the UK. Technically, the website is built on WordPress using Elementor, with integrations for SEO (Yoast), analytics (Google Analytics, Facebook Pixel), and customer reviews (Trustpilot). The site is mobile-optimized and performs moderately well, with good SEO practices and basic accessibility features. Security posture is adequate with HTTPS enforced and form validation implemented, though there is room for improvement in security headers and published security policies. Overall, the security posture is solid with no critical vulnerabilities detected. Privacy compliance is supported by a clear privacy policy and cookie consent mechanism, though explicit incident response and vulnerability disclosure policies are absent. The domain WHOIS data aligns with the business claims, indicating legitimacy and consistency. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and improving accessibility compliance to further strengthen trust and compliance.

15
28
-
70
-
60
100
insurancefcaapprovedlifeinsurancehomeinsurancehealthinsurance+3 more
WordPressElementorjQueryYoast SEO+2
2025-06-21T18:21:55.061Z
blevinsfranks.com favicon

Blevins Franks

blevinsfranks.com

0
FinanceUnited KingdomlargeMEDIUM

Blevins Franks is a well-established financial advisory firm specializing in cross-border tax, wealth management, pensions, investments, and estate planning services primarily targeting British expatriates living in Europe. With over 50 years of experience and multiple offices across Europe and the UK, the company holds a strong market position as a leading adviser for UK nationals abroad. Their business model focuses on personalized financial planning and advisory services, supported by a comprehensive digital presence and strong regulatory compliance across jurisdictions including the UK, Malta, and France. Technically, the website is built on a modern WordPress CMS platform with WooCommerce integration, leveraging popular libraries such as jQuery and FontAwesome. It employs Google Analytics, Facebook Pixel, and Google Tag Manager for marketing and analytics purposes, alongside a cookie consent management system to ensure GDPR compliance. The site demonstrates good mobile optimization, SEO practices, and user experience design, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS and uses standard WordPress security practices, though explicit security headers are not clearly detected and could be improved. No critical vulnerabilities or exposed sensitive data were found. Privacy compliance is strong with clear privacy and cookie policies, and contact information is readily available. However, the absence of an incident response contact or vulnerability disclosure policy suggests room for enhancement in security transparency. Overall, Blevins Franks presents a trustworthy, professional, and compliant online presence with a solid business foundation. Strategic recommendations include enhancing security headers, publishing incident response and vulnerability disclosure information, and further improving accessibility features to maintain high standards in security and compliance.

35
33
5
60
-
80
100
financetaxplanningwealthmanagementexpatriatescross-border+3 more
WordPress 6.8.1WooCommerce 9.8.5jQuery 3.7.1FontAwesome 5.15.3+4
2025-06-21T18:21:54.747Z
kidstart.co.uk favicon

KidStart Limited

kidstart.co.uk

0
FinanceUnited KingdommediumMEDIUM

KidStart Limited operates a UK-based cashback platform designed to help families save money for their children by earning cashback on everyday online purchases from a wide range of partner retailers. The website is well-branded and targets parents, grandparents, and family members interested in building savings for children. The business model leverages affiliate partnerships with major retailers and financial services, including a Junior ISA offering. The site demonstrates a solid market position with visible trust indicators such as FCA authorization and customer testimonials. Technically, the website uses a traditional tech stack including jQuery, Font Awesome, Facebook SDK, and Google Analytics. While the site is mobile-optimized and has good SEO practices, some technical debt is evident with the use of an older jQuery version and lack of modern security headers. Performance is moderate, and accessibility is basic but functional. From a security perspective, the site enforces HTTPS and integrates secure Facebook OAuth login flows. However, it lacks explicit security headers and uses an outdated JavaScript library version, which could expose it to vulnerabilities. Privacy compliance is strong with clear privacy and cookie policies and GDPR indicators. No direct contact emails or phone numbers are provided on the main pages, which may affect user trust slightly. Overall, KidStart presents a trustworthy and professional online presence with a good balance of business credibility and privacy compliance. Security posture is adequate but could be improved by updating libraries and adding security headers. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic improvements in security and contact transparency would enhance trust and resilience.

55
43
-
85
-
70
100
cashbackchildrensavingsfamilyfinanceshoppinguk+2 more
jQuery 1.10.1Font AwesomeFacebook SDKGoogle Analytics+2

Partner Domains:

beanstalkapp.co.uk
partner
smart.link
partner
2025-06-21T18:21:54.663Z
canddi.com favicon

Campaign and Digital Intelligence Limited

canddi.com

0
TechnologyUnited KingdommediumLOW

Campaign and Digital Intelligence Limited, operating under the brand CANDDi, is a UK-based technology company founded in 2009 specializing in website visitor tracking software. Their platform enables businesses to identify and analyze visitors to their websites, converting anonymous traffic into actionable leads for sales and marketing teams. The company positions itself as a mature player in the visitor analytics market, offering integrations with CRM systems and marketing tools to enhance lead generation and attribution. Technically, the website employs modern JavaScript frameworks, integrates third-party services such as Google Tag Manager, Calendly, and Wistia for analytics, scheduling, and video content respectively. The site is mobile-optimized with good SEO practices and a professional design, although accessibility features could be improved. Performance is moderate, with asynchronous loading of scripts and optimized assets. From a security perspective, the site enforces HTTPS with a strong SSL configuration and avoids exposing sensitive data in its HTML. However, explicit security policies and incident response contacts are not published, and security headers are not evident. The use of third-party tracking and marketing scripts is extensive but appears managed responsibly with privacy compliance in mind, including GDPR adherence and cookie consent mechanisms. Overall, the website demonstrates a high level of professionalism, trustworthiness, and business credibility. The domain registration details align well with the company's claims, reinforcing legitimacy. Strategic recommendations include enhancing security transparency, improving accessibility, and maintaining vigilance on third-party script security to sustain trust and compliance.

80
80
25
87
77
85
100
visitortrackingleadgenerationmarketinganalyticscrmintegrationb2bsaas
JavaScriptGoogle Tag ManagerCalendly integrationFontAwesome+1
2025-06-19T10:46:55.753Z
enricheducationuk.com favicon

Enrich Education

enricheducationuk.com

0
EducationUnited KingdomsmallMEDIUM

Enrich Education is a UK-based company specializing in creative and innovative educational services and products aimed at schools. Their offerings focus on promoting physical activity through school orienteering, cross-curricular outdoor learning, and Quidditch programs. The company holds several national endorsements and partnerships, positioning it as a recognized leader in youth sport education. Their digital platform provides schools with personalized content and extensive resources, supporting their mission to enhance young people's health and well-being through active learning. Technically, the website is built on a modern WordPress CMS with WooCommerce for e-commerce capabilities. It integrates multiple analytics and marketing tools such as Google Analytics, Google Tag Manager, Facebook Pixel, Twitter Tag, and LinkedIn Insight Tag. The site employs reCAPTCHA v3 for bot protection and uses a GDPR-compliant cookie consent mechanism via the Complianz plugin. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital infrastructure. From a security perspective, the website enforces HTTPS with an excellent SSL configuration and uses reCAPTCHA to protect forms. While explicit security headers like CSP or X-Frame-Options are not visibly confirmed, no vulnerabilities or exposed sensitive data were detected. The site lacks a published security policy or incident response contact, which could be improved to enhance trust and compliance. Overall, Enrich Education presents a professional, trustworthy, and well-maintained online presence with strong business credibility and compliance posture. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic recommendations include enhancing security headers, publishing security policies, and continuous monitoring to maintain a robust security posture.

15
85
10
85
67
85
100
educationorienteeringquidditchoutdoorlearningyouthsport+3 more
WordPress 6.8.1WooCommerce 9.8.5WooCommerce SubscriptionsGoogle Tag Manager+10

Partner Domains:

edwin.group
parent
2025-06-18T18:35:04.169Z
yonderdatasolutions.com favicon

Yonder Data Solutions

yonderdatasolutions.com

0
OtherUnited KingdommediumMEDIUM

Yonder Data Solutions is a UK-based trusted fieldwork and data collection company specializing in high-quality data capture and analytics solutions. The company serves businesses and organizations seeking reliable market research and data-driven insights. Their market position is strong, supported by industry certifications such as ISO 20252:2019 and MRS accreditations, and they emphasize data quality and innovation through their Data Quality Charter. The website reflects a professional and content-rich presence with clear service offerings and case studies highlighting their expertise. Technically, the website is built on WordPress with Elementor, leveraging modern web technologies including Google Tag Manager and CookieYes for consent management. The site is mobile-optimized, SEO-friendly, and demonstrates good performance and accessibility standards. The use of structured data enhances search engine understanding and trust. From a security perspective, the site enforces HTTPS with an excellent SSL configuration and implements cookie consent mechanisms aligned with GDPR. While some security headers are not explicitly detected, the overall posture is strong with no visible vulnerabilities or exposed sensitive data. The absence of an incident response contact or vulnerability disclosure page is noted as an area for improvement. Overall, the website and business demonstrate high credibility and trustworthiness with a solid compliance framework. Strategic recommendations include enhancing security headers, publishing incident response information, and adding a vulnerability disclosure policy to further strengthen security and trust.

25
88
25
85
42
85
100
datacollectionfieldworkanalyticsmarketresearchiso20252+5 more
WordPressElementorGoogle Tag ManagerGoogle Analytics+1
2025-06-18T13:07:27.983Z
yonderconsulting.com favicon

Yonder Consulting Limited

yonderconsulting.com

0
OtherUnited KingdommediumMEDIUM

Yonder Consulting Limited is a UK-based business consultancy specializing in blending research, strategy, and imagination to help clients identify business opportunities and enhance brand strategy. The company operates internationally with offices in London, New York, and Singapore, serving businesses seeking customer-driven success. Their proprietary tools like the Yonder Clockface and Culture Magnet demonstrate a focus on attitudinal segmentation and culture assessment, positioning them as a thoughtful and innovative consultancy in their market segment. Technically, the website is built on WordPress with Elementor, leveraging modern web technologies and animations to deliver a professional and engaging user experience. The site is well-optimized for SEO and mobile devices, with good accessibility and performance metrics. Security-wise, the site enforces HTTPS, employs security headers, and integrates a comprehensive cookie consent mechanism compliant with GDPR. However, explicit security and incident response policies are not published, representing an area for improvement. Overall, the domain registration details align well with the business claims, supporting the legitimacy and trustworthiness of the company.

25
88
25
97
42
85
100
businessconsultancystrategycustomerinsightbrandstrategyiso20252+2 more
WordPressElementorBootstrap 4jQuery+4

Partner Domains:

yonderdatasolutions.com
partner
2025-06-18T13:07:22.971Z
mediahawk.co.uk favicon

Mediahawk Ltd

mediahawk.co.uk

0
TechnologyUnited KingdommediumMEDIUM

Mediahawk Ltd is a UK-based technology company specializing in call analytics and marketing attribution software. Their platform enables marketers to track and analyze calls from both online and offline sources, providing actionable insights to improve marketing ROI. Trusted by over 4,000 marketers, Mediahawk offers a comprehensive suite of services including call tracking, speech analytics, sales matching, and integrations with major platforms such as Google and Salesforce. The website reflects a mature digital presence with professional design, clear navigation, and extensive client testimonials and case studies. Technically, the website is built on WordPress using the Flynt theme framework and employs modern performance and security optimizations such as WP Rocket, lazy loading, Google Tag Manager, Facebook Pixel, and Hotjar. HTTPS is enforced with a strong SSL configuration. However, some security headers could be improved to enhance protection. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The security posture is solid with no critical vulnerabilities detected, but there is room for improvement in publishing explicit security policies and incident response information. Overall, the website demonstrates a high level of professionalism, trustworthiness, and technical maturity, supporting Mediahawk's position as a leading call analytics provider. Strategic recommendations include enhancing security headers, publishing a vulnerability disclosure policy, and continuing to monitor third-party scripts for vulnerabilities to maintain a strong security posture.

15
88
25
70
32
65
100
calltrackingmarketingattributionspeechanalyticscallanalyticsmarketinganalytics+3 more
WordPressWP RocketGoogle Tag ManagerFacebook Pixel+4

Partner Domains:

support.mediahawk.co.uk
service
docs.mediahawk.co.uk
service

+1 more partners

2025-06-18T13:04:55.366Z
doctify.com favicon

Doctify

doctify.com

0
HealthcareUnited KingdomlargeMEDIUM

Doctify is a prominent online platform that enables patients to find and book healthcare providers, including specialists, clinics, and hospitals, supported by verified patient reviews and peer endorsements. The platform serves a large user base with over 30,000 experts and 50 million patient views globally, positioning itself as a trusted intermediary in the healthcare sector. Its business model focuses on enhancing transparency and trust in healthcare services by providing detailed provider profiles and facilitating appointment bookings. Technically, Doctify employs a modern web infrastructure leveraging React and Next.js frameworks, combined with Material-UI for a responsive and accessible user interface. The site integrates multiple analytics and marketing tools such as Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag, alongside a consent management platform to ensure GDPR compliance. The website demonstrates excellent performance, mobile optimization, and SEO practices. From a security perspective, Doctify enforces HTTPS with strong SSL configurations and implements essential security headers. It maintains user privacy through comprehensive cookie and privacy policies and employs a consent mechanism for data processing. No critical vulnerabilities or exposed sensitive data were detected, indicating a mature security posture. Overall, Doctify presents a low-risk profile with strong business credibility, technical sophistication, and privacy compliance. Strategic recommendations include publishing explicit security policies, establishing a vulnerability disclosure program, and enhancing transparency around data protection officer contacts to further strengthen trust and compliance.

15
80
25
70
67
80
100
healthcaremedicalpatientreviewsbookingspecialists+5 more
ReactNext.jsMaterial-UIGoogle Tag Manager+3
2025-06-18T13:04:41.954Z
dash.app favicon

Bright Interactive Limited

dash.app

0
TechnologyUnited KingdommediumMEDIUM

Dash.app is a digital asset management platform designed for growing brands, particularly in the ecommerce and direct-to-consumer sectors. The platform offers a comprehensive suite of services including asset collection, organization, collaboration, and deployment, positioning itself as an easy-to-use and scalable solution. The website reflects a professional and consistent brand image, supported by strong customer testimonials and industry certifications such as ISO 27001 and Carbon Neutral status. Technically, the site leverages modern web technologies including Webflow CMS, HubSpot forms, Visual Website Optimizer for A/B testing, and Cookiebot for consent management. The infrastructure is supported by reliable CDN providers and integrates multiple marketing and analytics tools, ensuring robust performance and user experience across devices. From a security perspective, the site enforces HTTPS, employs standard security headers, and manages user consent effectively. While no critical vulnerabilities or exposed sensitive data were detected, the absence of a public vulnerability disclosure policy and explicit incident response contacts are noted areas for improvement. Overall, Dash.app demonstrates a mature digital presence with strong business credibility, technical implementation, and privacy compliance, making it a trustworthy platform for its target audience.

60
88
33
85
69
80
100
digitalassetmanagementsaasmarketingecommercecustomertestimonials+2 more
JavaScriptjQueryHubSpot FormsVisual Website Optimizer (VWO)+2

Partner Domains:

signup.dash.app
service
login.dash.app
service

+1 more partners

2025-06-18T11:41:23.551Z
T

The London School of English Ltd

londonschool.com

0
EducationUnited KingdommediumMEDIUM

The London School of English Ltd is a well-established educational organization founded in 1912, specializing in English language training for adult learners. It offers a broad range of courses including General English, Business English, Legal English, exam preparation, and corporate training both online and in-person. The school holds a strong market position as the longest-established English language school in Britain, with excellent Trustpilot ratings and perfect British Council inspection scores, reflecting its commitment to quality education. Technically, the website employs a modern technology stack including Google Tag Manager, Facebook Pixel, Hotjar, HubSpot, and Stripe for payments, supported by a responsive and accessible design. The site is well-optimized for SEO and mobile devices, with comprehensive cookie consent management and multiple language support. Hosting appears to be on a reliable cloud platform, and performance is moderate. From a security perspective, the site enforces HTTPS, uses security headers, and integrates secure payment processing. It employs CSRF protection and bot management cookies, but lacks a dedicated security policy or incident response page. User tracking is extensive but managed with a clear cookie consent mechanism, indicating good privacy compliance. Overall, the website demonstrates a high level of professionalism, trustworthiness, and digital maturity. Strategic recommendations include publishing explicit security and incident response policies, enhancing accessibility further, and maintaining regular audits of third-party scripts to sustain security posture.

60
58
-
70
-
80
100
educationenglishlanguageschoolonlinecoursescorporatetraininglanguagelearning+2 more
HTML5CSS3JavaScriptGoogle Tag Manager+9

Partner Domains:

marketing.londonschool.info
partner
giantdigital.co.uk
partner
2025-06-18T08:56:11.167Z
toyota-forklifts.co.uk favicon

Toyota Material Handling UK

toyota-forklifts.co.uk

0
TransportationUnited KingdomlargeMEDIUM

Toyota Material Handling UK is a leading provider of forklift trucks and material handling equipment, offering a comprehensive range of products including hand pallet trucks, powered pallet trucks, stackers, order pickers, reach trucks, and counterbalance forklifts with various energy solutions. The company holds a strong market position as the global number one in material handling since 2001, supported by a national service network and a broad portfolio of services such as rental, used trucks, service packages, parts, operator training, and fleet management solutions. Their website reflects a mature digital presence with professional design, clear navigation, and mobile optimization. Technically, the website employs modern web technologies including jQuery, Bootstrap, React components, and integrates multiple third-party services such as Google Tag Manager, Cookiebot for consent management, Hubspot for marketing, and Hotjar for analytics. The site is hosted on secure infrastructure with HTTPS enforced and uses CDN services for performance. SEO and accessibility practices are well implemented, supported by structured data and meta tags. From a security perspective, the site demonstrates good practices including HTTPS, CSRF protection on forms, and comprehensive cookie consent mechanisms. No critical vulnerabilities or exposed sensitive data were detected. However, there is no explicit security policy or incident response contact information published, which could be improved to enhance trust and compliance. Overall, the website and business exhibit a high level of professionalism, security, and compliance with privacy regulations such as GDPR. Strategic recommendations include publishing a dedicated security policy, providing incident response contacts, implementing a security.txt file, and continuously auditing third-party scripts to maintain security posture.

50
58
5
93
-
70
100
forkliftmaterialhandlingtoyotalogisticsrental+5 more
jQueryBootstrap 3.3.1Google Tag ManagerCookiebot+5

Partner Domains:

hubspot.com
partner
cookiebot.com
partner

+3 more partners

2025-06-18T08:56:09.451Z
ergonomic-solutions.net favicon

Ergonomic Solutions

ergonomic-solutions.net

0
RetailUnited KingdommediumMEDIUM

Ergonomic Solutions is a UK-based established global supplier specializing in innovative and ergonomic technology mounting solutions primarily for the retail sector, including point-of-sale, self-service kiosks, digital signage, and tablet enclosures. With over 25 years of experience and a strong market presence, the company serves major retailers worldwide, boasting that 60% of the top 50 retailers use their SpacePole technology. Their business model focuses on B2B supply and custom solutions, supported by certifications such as ISO 9001 and ISO 14001, underscoring their commitment to quality and environmental management. Technically, the website employs modern web technologies including Bootstrap, Plyr video player, and Elfsight widgets, integrated with ClickDimensions for marketing and analytics. The site is well-optimized for mobile and accessibility, with good SEO practices and a professional design that enhances user experience. Privacy and cookie compliance are robust, featuring a consent banner and detailed policies. From a security perspective, the site uses HTTPS and demonstrates good security practices, although some security headers are not explicitly visible and could be improved. There is no evidence of exposed sensitive data or vulnerabilities in the HTML content. The absence of a public incident response contact or security.txt file suggests room for enhancement in vulnerability disclosure and incident management. Overall, Ergonomic Solutions presents a trustworthy and professional online presence with strong business credibility and technical maturity. The domain registration details align well with the company's claims, reinforcing legitimacy. Strategic recommendations include enhancing security headers, publishing incident response contacts, and implementing a security.txt file to further strengthen security posture and transparency.

15
70
-
70
-
85
100
technologymountingsolutionspointofsaledigitalsignageself-servicekiosksretailtechnology+3 more
HTML5CSS3JavaScriptBootstrap+4

Partner Domains:

spacepole.com
partner
2025-06-18T08:56:08.378Z
majentasolutions.com favicon

Majenta Solutions

majentasolutions.com

0
ManufacturingUnited KingdommediumMEDIUM

Majenta Solutions is a UK-based strategic digital engineering consultancy specializing in services for the construction and automotive sectors. Their offerings include strategic consultancy, model management, information management, and CAD services, supporting clients from design through to operational handover. The company positions itself as a trusted partner for navigating digital supply chains and digital transformation, targeting owner operators, contractors, consultants, and manufacturers within their industries. The website reflects a professional and consistent brand image with comprehensive content and clear navigation. Technically, the website is built on the Webflow platform, leveraging modern web technologies such as jQuery, Google Tag Manager, and Typekit fonts. It demonstrates good performance, mobile optimization, and accessibility features. Privacy compliance is robust, with a cookie consent mechanism powered by iubenda and a clear privacy policy. The site uses secure HTTPS connections and submits form data securely to Salesforce. From a security perspective, the site shows good practices including HTTPS enforcement and cookie consent management. However, it lacks publicly available security policies, incident response contacts, and vulnerability disclosure mechanisms, which are recommended for enhanced trust and compliance. No critical vulnerabilities or exposed sensitive data were detected. Overall, Majenta Solutions presents a credible and professional online presence with a solid technical foundation and good privacy compliance. Strategic improvements in security transparency and incident response readiness would further strengthen their security posture and trustworthiness.

45
28
5
70
-
75
100
digitalengineeringconsultancyconstructionautomotivecadservices+4 more
Webflow CMSjQuery 3.5.1Google Tag Manageriubenda cookie consent+3
2025-06-18T08:56:06.332Z
evoxtherapeutics.com favicon

Evox Therapeutics

evoxtherapeutics.com

0
HealthcareUnited KingdommediumMEDIUM

Evox Therapeutics is a UK-based biotechnology company specializing in transformative exosome therapeutics targeting severe neurological and neurodegenerative diseases. Leveraging proprietary ExoEdit™ technology and CRISPR/Cas gene editing encapsulated in exosome nanoparticles, Evox aims to develop innovative treatments addressing critical unmet medical needs. The company maintains a professional and content-rich website that clearly communicates its mission, pipeline, technology, and partnership opportunities, targeting patients, healthcare professionals, investors, and collaborators. Technically, the website is built on WordPress using the GeneratePress theme and Elementor page builder, incorporating modern web technologies such as jQuery and Font Awesome. SEO is enhanced via Yoast SEO plugin, and Google Tag Manager is used for analytics and marketing. The site is mobile-optimized with good navigation and accessibility features, although some accessibility and security header improvements are recommended. From a security perspective, the site enforces HTTPS and shows no signs of exposed sensitive data or vulnerable libraries. However, explicit security headers like Content-Security-Policy and X-Frame-Options are not detected, and no formal security or incident response policies are published. Privacy compliance is partially addressed with a comprehensive privacy policy and terms of service, but lacks a cookie consent mechanism. Overall, Evox Therapeutics presents a credible and trustworthy online presence consistent with its business claims and domain registration data. Strategic recommendations include enhancing security headers, implementing cookie consent, publishing security policies, and improving accessibility to strengthen compliance and trust.

30
28
-
85
-
85
100
biotechnologyhealthcareexosometherapeuticsgeneeditingneurologicaldiseases+2 more
WordPressElementorYoast SEOjQuery+2
2025-06-18T08:56:00.563Z
franklincovey.co.uk favicon

FranklinCovey

franklincovey.co.uk

0
EducationUnited KingdomlargeMEDIUM

FranklinCovey is a globally recognized leadership development company that specializes in transforming organizations by building exceptional leaders, teams, and cultures. With over 35 years of experience and operations in more than 160 countries, FranklinCovey offers a comprehensive suite of leadership courses, technology platforms, and consulting services. Their business model includes digital subscriptions such as the All Access Pass, live and online events, and apprenticeship partnerships, targeting business leaders and organizations seeking to improve effectiveness and results. Technically, the website is built on WordPress with modern frameworks like Bootstrap and UIkit, integrating advanced marketing and analytics tools including Marketo, Google Analytics, and OneTrust for cookie consent. The site demonstrates good mobile optimization, accessibility, and SEO practices, reflecting a mature digital infrastructure. From a security perspective, the site uses HTTPS with good SSL configuration and employs reCAPTCHA for form protection. Cookie consent is managed via OneTrust, ensuring GDPR compliance. However, explicit security headers like CSP and X-Frame-Options are not evident and could be improved. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website presents a professional, trustworthy, and compliant digital presence with strong business credibility. Strategic recommendations include enhancing security headers, continuous monitoring of third-party scripts, and maintaining robust data protection practices to further strengthen security posture and user trust.

35
63
13
80
-
70
100
leadershiptrainingeducationbusinessconsulting+2 more
WordPressBootstrap 4.3.1Gravity FormsMarketo Forms+9

Partner Domains:

app-lon08.marketo.com
service
munchkin.marketo.net
service
2025-06-18T08:55:52.455Z
volumeglobal.com favicon

Ride Shotgun

volumeglobal.com

0
MediaUnited KingdommediumMEDIUM

Ride Shotgun is a global brand activation and creative content agency offering a comprehensive suite of marketing services including brand strategy, creative activation, and content production. With offices across the UK, US, Europe, and Asia, they serve a diverse client base with a joined-up approach to marketing. The website demonstrates strong market positioning with extensive case studies, client logos, and testimonials, reflecting a mature and professional business model. Technically, the website is built on WordPress with HubSpot CMS integrations, leveraging modern JavaScript libraries and marketing analytics tools such as Google Analytics, Microsoft Clarity, and LinkedIn Insight Tag. The site is mobile-optimized with good SEO and accessibility features, though some accessibility improvements could be made. From a security perspective, the site enforces HTTPS and uses secure forms via HubSpot. While explicit security headers are not fully confirmed, no vulnerabilities or exposed sensitive data were detected. Privacy and cookie policies are comprehensive and GDPR compliant, supporting a strong privacy posture. Overall, the website presents a low risk profile with high professionalism and trustworthiness. Strategic recommendations include enhancing security headers, improving accessibility compliance, and formalizing incident response and vulnerability disclosure policies to further strengthen security and compliance.

40
58
-
70
-
75
100
brandactivationcreativecontentmarketingagencydigitalmarketingcontentproduction+1 more
JavaScriptjQuerySlick CarouselHubSpot Forms+5
2025-06-18T08:55:49.064Z
evolution-timecritical.com favicon

Evolution Time Critical

evolution-timecritical.com

0
TransportationUnited KingdommediumHIGH

Evolution Time Critical is a UK-based logistics company specializing in urgent and critical supply chain solutions. With over 20 years of experience and a strong market position, it offers a wide range of services including emergency logistics, critical deliveries, express deliveries, and supply chain analysis. The company operates globally with multiple control centers and is a subsidiary of Metro Supply Chain. The website reflects a professional and well-branded digital presence with comprehensive content and clear navigation. Technically, the website is built on WordPress with modern technologies such as jQuery, Google Analytics, HubSpot, and Contact Form 7. It is mobile-optimized and SEO-friendly, though some accessibility features could be enhanced. Security practices include HTTPS enforcement and use of Google reCAPTCHA on forms, but additional security headers and a public security policy are absent. The security posture is solid with no visible vulnerabilities or exposed sensitive data. Privacy compliance is good, with a clear privacy policy and cookie consent mechanism aligned with GDPR. Contact information is comprehensive and clearly presented. Overall, the website demonstrates a mature digital infrastructure supporting the company's business goals. Strategically, the company should consider publishing a formal security policy and vulnerability disclosure to enhance trust and compliance. Improving accessibility and security headers would further strengthen the security posture and user experience.

15
43
-
75
-
80
20
logisticsurgentlogisticssupplychaintransportemergencylogistics+6 more
WordPressjQueryGoogle AnalyticsHubSpot+2

Partner Domains:

metroscg.com
parent
2025-06-18T08:55:47.145Z
bankunderground.co.uk favicon

Bank of England

bankunderground.co.uk

0
FinanceUnited KingdomenterpriseMEDIUM

Bank Underground is an official research blog operated by the Bank of England, providing a platform for staff to share research and views on financial stability, monetary policy, and related economic topics. The website serves as a knowledge-sharing hub targeting Bank of England staff, economists, policymakers, and interested members of the public. It maintains a strong market position as an authoritative source of financial research and policy discussion. The technical infrastructure is based on WordPress CMS hosted on WordPress.com, leveraging modern technologies such as Jetpack, CookieYes for cookie consent management, and Google Analytics for traffic analysis. The site demonstrates excellent performance, mobile optimization, and accessibility, with a professional and consistent design. Security posture is solid with HTTPS enforced, standard security headers likely in place, and no visible vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with a comprehensive privacy policy and cookie consent mechanism, including GDPR compliance indicators. However, explicit security policies, incident response contacts, and vulnerability disclosure mechanisms are absent. Overall, the website is trustworthy, professionally maintained, and aligned with the Bank of England's standards. Strategic recommendations include adding explicit security and incident response policies, publishing vulnerability disclosure information, and providing direct contact details for data protection and security inquiries.

30
88
25
60
39
60
100
bankingfinancialstabilitymonetarypolicymacroeconomicsfinancialmarkets+7 more
WordPressPHPJavaScriptGoogle Fonts (Open Sans)+4
2025-06-18T08:52:07.805Z
click4assistance.co.uk favicon

Click4Assistance

click4assistance.co.uk

0
TechnologyUnited KingdommediumMEDIUM

Click4Assistance is a UK-based technology company specializing in live chat software, chatbots, and AI agent solutions for business websites. With over 20 years of experience, the company offers GDPR-compliant, fully customizable web chat solutions integrated with omni channel messaging platforms such as WhatsApp and Facebook Messenger. Their market position is strong within the UK, serving thousands of clients including notable brands like Honeywell and Barnardos. The company emphasizes UK data residency and compliance with key certifications such as ISO 27001:2022 and GDPR. Technically, the website leverages modern frameworks including Blazor Server and jQuery, with robust consent management via Cookiebot and analytics through Google Tag Manager. The site is well-optimized for performance, mobile responsiveness, and accessibility, reflecting a mature digital infrastructure. Security practices include HTTPS enforcement, CSRF protection, and comprehensive cookie consent mechanisms, contributing to a strong security posture. While the site demonstrates excellent compliance and security maturity, it lacks explicit incident response contact details and a vulnerability disclosure policy, which are recommended for enhanced transparency and readiness. Overall, the website presents a professional, trustworthy, and technically sound platform aligned with its business objectives and regulatory requirements.

50
95
25
65
82
65
100
livechatchatbotsaiagentsgdprukbusiness+3 more
Blazor ServerjQueryGoogle Tag ManagerCookiebot Consent Management
2025-06-18T08:51:55.406Z
public-i.tv favicon

Public-i Group Ltd

public-i.tv

0
GovernmentUnited KingdommediumMEDIUM

Public-i Group Ltd is a well-established provider specializing in live streaming, remote and hybrid meetings, audio-visual solutions, and event webcasting primarily for local government entities in the United Kingdom. With over two decades of experience since its founding in 2000, Public-i has positioned itself as a market leader offering comprehensive, scalable, and integrated solutions that enhance meeting accessibility, transparency, and engagement. Their product suite includes Connect Webcasting, HybridLink, SpaceManager, CameraControl, and Connect Remote, all designed to streamline meeting management and digital audience reach. Technically, the website is built on a modern WordPress platform utilizing popular plugins and libraries such as WPBakery Page Builder, jQuery, Google reCAPTCHA, and Cookiebot for consent management. The site demonstrates good performance, mobile optimization, and accessibility features, reflecting a mature digital infrastructure. Security measures include HTTPS enforcement, reCAPTCHA integration, and comprehensive cookie consent mechanisms, contributing to a strong security posture. The security evaluation reveals a robust implementation of best practices, including secure forms, no exposed sensitive data, and use of recognized certifications like ISO 9001 and Cyber Essentials. However, the absence of a public incident response page and security.txt file suggests areas for improvement in transparency and vulnerability management. Overall, Public-i presents a professional, trustworthy, and compliant online presence with clear contact channels, detailed policies, and strong trust indicators. The domain registration details align well with the business claims, reinforcing legitimacy. Strategic recommendations include enhancing vulnerability disclosure, publishing incident response procedures, and continuous monitoring of third-party integrations to maintain security and compliance.

25
83
25
85
77
85
20
livestreaminghybridmeetingsremotemeetingsaudiovisuallocalgovernment+2 more
WordPressWPBakery Page BuilderjQueryGoogle reCAPTCHA+3
2025-06-18T08:21:25.135Z