
F
Formspree
formspree.io
TechnologyUnited StatesmediumMEDIUM Formspree, Inc is a US-based technology company founded in 2014 that provides a SaaS form backend, API, and email service tailored for developers and businesses seeking to embed custom forms without server code. The company enjoys a strong market position, trusted by over 500,000 users including freelancers, agencies, and Fortune 500 companies such as Amazon, OpenAI, and Adobe. Their key services include spam filtering, email notifications, third-party integrations, and easy-to-use popup forms, positioning them as a reliable form solution provider in the developer tools space.
Technically, the website is built using the Hugo static site generator and leverages modern analytics platforms including Google Analytics, Amplitude, and PostHog. Hosting and DNS services are provided by Cloudflare, ensuring fast performance and robust infrastructure. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital presence. Security practices include HTTPS enforcement, machine learning spam filtering, reCaptcha integration, and custom spam rules, although DNSSEC is not enabled and some security headers may be missing.
From a security standpoint, Formspree demonstrates a solid posture with no visible vulnerabilities or exposed sensitive data. Privacy and terms of service policies are comprehensive and GDPR compliant, though explicit incident response contacts and vulnerability disclosure policies are absent. The domain registration data aligns well with the website content, reinforcing legitimacy and trustworthiness.
Overall, Formspree presents a professional, secure, and privacy-conscious service with excellent content quality and technical implementation. Strategic improvements could include enabling DNSSEC, publishing a security.txt file, and adding cookie consent mechanisms to enhance compliance and security transparency.
formsformbackendapiemailservicespamfiltering+2 more Hugo static site generatorGoogle AnalyticsAmplitude analyticsPostHog analytics+4