Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 2441 of 2975|Showing 122001-122050 of 148741
bluebridgetechnologies.com favicon

BlueBridge Technologies

bluebridgetechnologies.com

0
HealthcareIrelandmediumMEDIUM

BlueBridge Technologies is a well-established digital health technology company specializing in medical device software development and regulatory compliance services. Founded in 2006 and operating primarily in the healthcare technology sector, the company serves major global med-tech and pharmaceutical clients, offering services that include software development, validation, cybersecurity, and regulatory consulting. Their market position is strengthened by recognized certifications such as ISO 14971, ISO 13485, and ISO 62304, and partnerships with leading industry players like Novartis and Medtronic. Technically, the website is built on a modern WordPress CMS platform with a professional design, good mobile optimization, and SEO best practices. The infrastructure is hosted by Blacknight Internet Solutions Ltd., an Irish registrar consistent with the company's geographic presence. The site uses common analytics and marketing tools with a GDPR-compliant cookie consent mechanism. From a security perspective, the site enforces HTTPS, employs security headers, and demonstrates compliance with medical device industry standards. No critical vulnerabilities or exposed sensitive data were detected. However, improvements such as enabling DNSSEC and publishing a security.txt file could enhance security posture further. Overall, BlueBridge Technologies presents a credible, professional, and secure online presence aligned with its business focus. Strategic recommendations include enhancing incident response transparency, improving accessibility, and formalizing vulnerability disclosure processes to maintain trust and compliance in a regulated industry.

15
100
47
40
57
70
100
medicaldevicesoftwaredigitalhealthregulatorycomplianceisocertificationshealthcaretechnology+5 more
WordPressWPBakery Page BuilderYoast SEOGoogle Analytics+5
2025-06-27T12:56:17.070Z
frigate.ch favicon

Austrenis Capital SA

frigate.ch

0
FinanceSwitzerlandsmallMEDIUM

Austrenis Capital SA is a Swiss-based investment business service provider specializing in asset management, investment advice, financial intermediary services, and documentary maintenance of financial and investment operations. The company targets investors seeking secure investment opportunities and operates a multipurpose investment platform. The website presents a professional and consistent brand image with clear navigation and relevant content, positioning Austrenis as a niche player in the finance sector in Geneva, Switzerland. Technically, the website uses modern web technologies including jQuery, AjaxForm, and Cloudflare Zaraz for script management and analytics. The site is hosted behind Cloudflare, providing good SSL configuration and moderate performance. Mobile optimization and accessibility are adequate but could be improved. SEO practices are basic with minimal meta descriptions and no structured data. From a security perspective, the site enforces HTTPS and uses secure form submission. However, it lacks explicit security headers and does not provide privacy or cookie policies, which are critical for GDPR compliance. The contact form posts data to an external domain (frigate.ch), which may raise data protection concerns. No incident response or vulnerability disclosure information is available, indicating room for improvement in security maturity. Overall, the website scores moderately well in business credibility and technical implementation but falls short in privacy compliance and security best practices. Strategic recommendations include publishing privacy and cookie policies, implementing security headers, clarifying data handling for forms, and enhancing GDPR compliance to improve trust and reduce risk.

55
35
2
80
60
85
100
investmentfinanceassetmanagementfinancialservicessecureinvestment
jQueryAjaxFormCloudflare ZarazHTML5+1
2025-06-27T12:56:17.053Z
premiummedical.lv favicon

Premium Medical

premiummedical.lv

0
HealthcareLatviamediumHIGH

Premium Medical is a premium-class medical clinic based in Riga, Latvia, offering a wide range of healthcare services including consultations, diagnostics, physiotherapy, aesthetic medicine, dental care, and specialized health programs. The clinic positions itself as the first premium medical institution in Latvia with over 100 specialists across 35 medical fields, targeting adults and children seeking high-quality healthcare. The website is professionally designed with excellent content quality, clear navigation, and mobile optimization, reflecting a mature digital presence. Technically, the site employs modern analytics and tracking tools such as Google Analytics, Yandex Metrika, Microsoft Clarity, and Facebook Pixel, indicating a strong marketing and user behavior analysis capability. Security-wise, the site enforces HTTPS and uses secure forms but lacks some recommended security headers and explicit published security policies, which could be improved to enhance trust and compliance. The absence of WHOIS data due to query limits limits domain trust verification, but the overall business presentation and contact transparency support legitimacy. Strategic recommendations include implementing security headers, publishing incident response and vulnerability disclosure policies, and maintaining regular audits of third-party scripts to strengthen security posture and compliance.

20
10
17
60
-
85
20
healthcaremedicalclinicdiagnosticspremiummedicalservicesriga+1 more
Google Tag ManagerGoogle AnalyticsYandex MetrikaMicrosoft Clarity+3
2025-06-27T12:56:17.041Z
medena.ch favicon

MEDENA AG

medena.ch

0
ManufacturingSwitzerlandmediumHIGH

MEDENA AG is a Swiss-based company specializing in the manufacturing and development of cosmetics, medical devices, and food supplements. With over 50 years of experience, the company offers a broad range of services including contract manufacturing, quality management, regulatory consulting, product development, and research. Their market position is that of an established, certified manufacturer serving international clients with a focus on compliance and quality standards such as ISO 13485, ISO 22716, and ISO 9001. The website reflects a professional B2B business model targeting companies seeking manufacturing and regulatory support in the healthcare and cosmetics sectors. Technically, the website is built on WordPress with modern JavaScript libraries and integrates Google Analytics and Tag Manager for tracking. The site is mobile optimized and has good SEO and accessibility basics. Security posture is strong with HTTPS, security headers, and no visible vulnerabilities, though explicit security policies and incident response information are absent. Privacy compliance is well addressed with a cookie consent mechanism and GDPR-aligned policies. Overall, the site is trustworthy and professionally maintained, supporting the company's credibility in its sector.

15
50
2
70
70
75
20
cosmeticsmedicaldevicesmanufacturingcontractmanufacturingqualitymanagement+3 more
WordPressjQueryGoogle AnalyticsGoogle Tag Manager+4
2025-06-27T12:56:17.035Z
latsign.lv favicon

LATSIGN

latsign.lv

0
ManufacturingLatviamediumHIGH

LATSIGN is a Latvian company specializing in the manufacturing and sale of personalized aluminum signs, including house number plates, nameplates, warning signs, and vehicle wrapping services. With over 30 years of industry experience, LATSIGN positions itself as a market leader in Latvia, serving both residential and business customers. The company operates an e-commerce platform built on Shopify, offering a wide range of customizable products and leveraging modern digital marketing and analytics tools to engage its audience. Technically, the website is well-structured, mobile-optimized, and integrates several third-party services such as Google Tag Manager, Facebook Pixel, Klaviyo, and Stamped.io for marketing and customer engagement. The platform uses Shopify's secure hosting and payment infrastructure, ensuring a good baseline security posture. The presence of hCaptcha on forms indicates attention to bot mitigation and form security. From a security perspective, the site benefits from HTTPS encryption and standard security headers provided by Shopify. However, explicit security policies, incident response contacts, and vulnerability disclosure mechanisms are absent, which could be improved to enhance trust and compliance. Privacy compliance is basic but includes a cookie consent banner and a privacy policy page in Latvian, indicating awareness of GDPR requirements. Overall, LATSIGN presents a professional and trustworthy online presence consistent with a medium-sized manufacturing and retail business in Latvia. The lack of WHOIS data limits domain registration verification, but the website content and business indicators suggest legitimacy. Strategic recommendations include publishing detailed security and incident response policies, enhancing privacy disclosures, and providing clear contact information for customer and security inquiries.

75
48
17
-
-
-
100
e-commercepersonalizationaluminumsignsvehiclewrappinglatvia+1 more
ShopifyJavaScriptGoogle Tag ManagerFacebook Pixel+3
2025-06-27T12:56:17.016Z
tribus.lv favicon

Tribus

tribus.lv

0
Real EstateLatviamediumMEDIUM

Tribus is a Latvian real estate company specializing in property listings and related services such as valuation, sales, and purchase facilitation. The company targets property buyers, sellers, developers, and non-residents interested in Latvian real estate. Their website is multilingual, supporting Latvian, Russian, and English, indicating a broad target audience. The business appears established since 2018 with a medium-sized market presence in Latvia's real estate sector. Technically, the website is built on WordPress using Bootstrap and jQuery, with integrations for Google Analytics, Google Tag Manager, and reCAPTCHA for form security. The site is mobile optimized and has good SEO practices, though accessibility features are basic. Performance is moderate, with modern but common web technologies. Security posture is generally good with HTTPS enabled and use of reCAPTCHA, but lacks explicit security headers and formal privacy or cookie policies. No WHOIS data was available due to query limits, limiting full domain trust assessment. No visible incident response or vulnerability disclosure policies were found. Overall, the website is professional and functional for its business purpose but would benefit from enhanced privacy compliance, security headers, and transparency regarding data protection and incident response.

60
83
17
60
-
85
100
realestatepropertylatviamultilingualwordpress+1 more
WordPressBootstrapjQueryGoogle Analytics+5
2025-06-27T12:56:17.007Z
korin.com favicon

Korin, Inc

korin.com

0
RetailUnited StatesmediumHIGH

Korin, Inc is a specialized e-commerce retailer focused on professional quality Japanese chef knives, tableware, kitchenware, and restaurant supplies. Established in 1982, the company serves professional chefs, restaurants, and culinary enthusiasts worldwide, offering a wide range of imported Japanese knives, sharpening stones, kitchen tools, and barware. The website demonstrates a strong market position in the niche culinary supply sector with worldwide shipping and additional services such as knife sharpening and custom engraving. Technically, the website is built on the NetSuite SuiteCommerce platform, utilizing modern JavaScript libraries and frameworks such as RequireJS and jQuery. The site is mobile-optimized with good SEO practices and moderate performance. However, some accessibility features could be improved. The technical infrastructure appears stable and professional, supporting a seamless user experience. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks visible security headers and explicit incident response or vulnerability disclosure information. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. The absence of WHOIS data for the domain raises concerns about domain registration legitimacy, though the website content and business presence appear credible. Overall, Korin.com is a professional and trustworthy e-commerce site with strong business credibility and good technical implementation. Addressing domain registration transparency, enhancing privacy compliance, and improving security headers would further strengthen its security posture and trustworthiness.

-
35
17
70
-
80
100
japanesekniveskitchenwaretablewarerestaurantsuppliese-commerce+1 more
JavaScriptAJAXRequireJSjQuery+2
2025-06-27T12:56:16.985Z
ziegler.com favicon

B.C. Ziegler and Company

ziegler.com

0
FinanceUnited StateslargeMEDIUM

B.C. Ziegler and Company operates as a specialty investment bank focusing on healthcare, senior living, education, and municipal finance sectors. The firm provides capital raising, strategic advisory, sales and trading, and proprietary investments. It holds a strong market position with top rankings in senior living financing and healthcare M&A. The website reflects a mature digital presence with professional design, clear navigation, and comprehensive content tailored to institutional clients and municipal entities. Technically, the website employs modern tracking and analytics tools such as Google Tag Manager and Hotjar, uses lazy loading for images, and is built on a SiteBuilder CMS platform. The site is mobile optimized and accessible, with good SEO practices. However, there is room for improvement in security headers and privacy compliance mechanisms. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. The absence of WHOIS data raises some concerns but is mitigated by the presence of regulatory trust signals and professional content. Privacy compliance could be enhanced by implementing cookie consent banners and publishing incident response contacts. Overall, the website and business demonstrate a high level of professionalism and trustworthiness, suitable for their target market. Strategic improvements in privacy and security transparency would further strengthen their risk profile and compliance stance.

55
53
2
65
-
85
100
investmentbankinghealthcarefinanceseniorlivingfinancingcapitalmarketsfhahudmortgagelending+2 more
Google Tag ManagerHotjarSlick CarouselLazyLoad images
2025-06-27T12:56:16.981Z
kbi.lv favicon

SIA Kurzemes Biznesa inkubators

kbi.lv

0
OtherLatviasmallHIGH

SIA Kurzemes Biznesa inkubators is a regional business incubator established in 2008, focused on supporting small and medium-sized enterprises in the Kurzeme region of Latvia. The company offers business management consulting, accounting services, digital marketing, and office space rental, positioning itself as a key facilitator of local business growth and innovation. Their website reflects a professional and consistent brand image with clear service offerings and contact information, targeting SMEs and startups in the region. Technically, the website is built on the Mozello CMS platform, leveraging Amazon CloudFront CDN for content delivery and using common JavaScript libraries such as jQuery and Fancybox. Google Analytics is integrated for visitor tracking, complemented by a cookie consent banner indicating GDPR compliance awareness. The site is mobile-optimized and demonstrates good SEO practices, although some accessibility features could be improved. From a security perspective, the site uses HTTPS with a strong SSL configuration and implements client-side form validation and cookie consent mechanisms. However, it lacks advanced security headers and does not provide explicit security or incident response policies. The absence of WHOIS data limits domain registration trust verification, but the visible business information and social media presence support legitimacy. Overall, the website presents a trustworthy and professional front for a small regional business incubator, with moderate technical sophistication and a good privacy posture. Strategic improvements in security headers, server-side validation, and transparency around security policies would enhance the security posture and trustworthiness further.

20
25
17
70
-
85
100
businessincubatoraccountingservicesdigitalmarketingofficerentallatvia+1 more
jQuery 2.2.4Fancybox 3BannerplayResponsiveVideos+2

Partner Domains:

greentechlatvia.eu
partner
2025-06-27T12:56:16.977Z
soft-fx.com favicon

Soft-FX

soft-fx.com

0
FinanceN/amediumHIGH

Soft-FX is a fintech software development company specializing in comprehensive FX and digital asset trading software solutions. The company targets brokerages, blockchain platforms, and proprietary trading firms, offering a broad portfolio of products including margin trading solutions, liquidity aggregation, deliverable trading software, and risk management tools. With over 30 completed projects and a presence in more than 22 countries, Soft-FX positions itself as a mature and innovative player in the financial technology sector. Technically, the website is built on the Ghost CMS platform and utilizes modern JavaScript libraries such as jQuery and Swiper for UI components. It integrates analytics and marketing tools including Google Tag Manager, Microsoft Clarity, and HubSpot forms, indicating a digitally mature infrastructure. The site is mobile-optimized and demonstrates good SEO and accessibility practices, although some accessibility features could be enhanced. From a security perspective, the site enforces HTTPS and uses asynchronous loading for third-party scripts, reducing performance impact and potential vulnerabilities. However, no explicit security headers were detected in the provided data, and there is no visible incident response or security policy documentation. The absence of WHOIS registration data raises concerns about domain legitimacy, although the website content and business presence appear professional and trustworthy. Overall, Soft-FX presents a strong business and technical profile with room for improvement in transparency and security documentation. The risk assessment is moderate due to the missing WHOIS data, but the operational and content quality supports a positive trust posture.

35
68
2
70
-
-
100
fintechforexdigitalassetstradingsoftwareliquidityaggregation+1 more
jQuery 2.2.4Swiper 9.4.1Google Tag ManagerMicrosoft Clarity
2025-06-27T12:56:16.975Z
nbs.rs favicon

Народна банка Србије

nbs.rs

0
FinanceSerbialargeMEDIUM

The website represents the official online presence of the National Bank of Serbia, the central bank responsible for monetary policy, financial stability, banking supervision, and payment systems in Serbia. It serves a broad audience including citizens, financial institutions, investors, and analysts by providing comprehensive financial data, news, and regulatory information. The site is professionally designed with clear navigation and multilingual support, reflecting a mature digital infrastructure. Technically, the site uses modern web technologies including Bootstrap, jQuery, FontAwesome, and charting libraries like C3.js and D3.js. It is hosted under a domain registered by TELEKOM SRBIJA A.D., indicating a reliable hosting environment. The site is mobile optimized and uses HTTPS, but lacks DNSSEC and explicit security headers, which are recommended for enhanced security. From a security perspective, the site shows good practices such as HTTPS enforcement and secure form handling. However, the absence of privacy and cookie policies, as well as missing security headers, represent compliance and security gaps. No WAF or blocking mechanisms were detected, and the domain registration is consistent and legitimate. Overall, the site is trustworthy and professional but would benefit from improved privacy compliance and enhanced security configurations to align with best practices and regulatory requirements.

15
35
17
70
72
60
100
centralbankfinancegovernmentmonetarypolicyfinancialstability+4 more
HTML5CSS3JavaScriptjQuery+4
2025-06-27T12:56:16.776Z
hansatelecom.com favicon

Hansatelecom Ltd.

hansatelecom.com

0
TelecommunicationsLatviasmallHIGH

Hansatelecom Ltd. is a telecommunications company based in Latvia, specializing in SIP trunking solutions for international business calls. The company emphasizes call quality, anti-fraud measures, fair pricing, and personalized customer service. Their website reflects a focused business model targeting enterprises requiring reliable international telephony services. The domain is well-established since 2005, consistent with the company's operational history. Technically, the website is built on WordPress 5.5.15 with jQuery and uses the Contact Form 7 plugin for customer interactions. The site is moderately optimized for mobile and performance but lacks advanced SEO and accessibility features. No analytics or tracking scripts were detected, indicating minimal user tracking. From a security perspective, the site uses HTTPS and has domain transfer protections but lacks DNSSEC and security headers such as Content-Security-Policy or Strict-Transport-Security. There are no visible privacy or cookie policies, which impacts compliance with GDPR and related regulations. Contact information is clearly provided, enhancing business credibility. Overall, the website presents a professional and trustworthy image but would benefit from enhanced privacy compliance and security hardening to improve its risk posture and regulatory adherence.

15
50
2
75
52
80
40
telecommunicationssiptrunkinginternationalcallsbusinessservicesanti-fraud+2 more
WordPress 5.5.15jQuery 1.12.4Contact Form 7 plugin
2025-06-27T12:56:16.761Z
P

PREPARE - Partnership for Rural Europe

preparenetwork.org

0
Non-profitGermanysmallHIGH

PREPARE - Partnership for Rural Europe is a small non-profit organization focused on fostering collaboration and development in rural European areas. The website serves as an informational and networking platform, offering newsletters, event information, and links to partner organizations. The business model centers on partnership and knowledge sharing within the rural development sector. The domain age and WHOIS data support the legitimacy of the organization, with registration dating back to 2003 and consistent registrant information from Germany. Technically, the website is built on an outdated Joomla! 1.5 CMS platform, which poses significant security risks due to lack of support and known vulnerabilities. The site lacks HTTPS, security headers, and modern security best practices. The technical infrastructure is basic, with moderate performance and limited mobile optimization. The site uses JavaScript libraries such as MooTools and jQuery but does not employ modern frameworks or analytics tools. From a security perspective, the absence of HTTPS and security headers, combined with an outdated CMS, significantly lowers the security posture. No privacy or cookie policies are present, and no contact information or incident response channels are clearly provided. These factors indicate low privacy compliance and limited security maturity. Overall, the website is functional but basic, with moderate business credibility but poor security and privacy compliance. Strategic improvements in security infrastructure, privacy policy implementation, and CMS modernization are recommended to enhance trust and protect user data.

15
25
-
65
-
70
100
preparepartnershipruraleuropenon-profitnetworking+2 more
JavaScriptMooToolsjQuery
2025-06-27T12:56:16.755Z
dorianlpg.com favicon

Dorian LPG Ltd

dorianlpg.com

0
EnergyUnited StatesmediumMEDIUM

Dorian LPG Ltd is a leading liquefied petroleum gas shipping company specializing in the ownership and operation of very large gas carriers (VLGCs). With a global footprint including offices in the United States, Greece, and Denmark, the company plays a critical role in transporting LPG to support the world's energy transition. The website serves primarily as an investor relations portal, providing comprehensive financial reports, ESG disclosures, and corporate governance information. The company is publicly traded on the NYSE under the ticker LPG, reinforcing its market credibility and transparency. Technically, the website is built on a mature ASP.NET WebForms platform integrated with Q4 Inc's investor relations tools, leveraging modern JavaScript libraries such as jQuery, Splide.js, and DataTables for enhanced user experience. The site demonstrates good mobile optimization, accessibility, and SEO practices, with a moderate performance profile. Security measures include HTTPS enforcement, Content Security Policy headers, anti-CSRF tokens, and Google reCAPTCHA integration, reflecting a solid security posture. No critical vulnerabilities or WAF blocks were detected, and the domain registration details align well with the company's public profile, indicating legitimacy and trustworthiness. Privacy and cookie policies are present and comprehensive, with active consent mechanisms, supporting GDPR compliance. However, explicit security policies, incident response contacts, and terms of service pages are absent, representing areas for improvement. Overall, the website is professional, secure, and well-suited for its investor relations purpose, though enhancements in security transparency and contact information could further strengthen trust and compliance.

35
83
17
85
57
85
100
investorrelationsenergytransportationlpgshippingsustainability+2 more
jQuerySplide.jsDataTablesGoogle reCAPTCHA+3
2025-06-27T12:56:16.698Z
D

Microsoft Azure Web App - Error 404

dockwise.com

0
OtherN/asmallHIGH

The domain dockwise.com is registered since 1997 and hosted on Microsoft Azure platform. However, the website currently serves only a default Azure 404 error page indicating that the site content is not configured or missing. There is no visible business information, branding, or contact details on the site. The lack of content and policies suggests the website is either under construction or abandoned. From a technical perspective, the site is hosted on Azure App Service but lacks HTTPS information and security headers in the provided data. No CMS or analytics tools are detected, and the site does not provide any forms or data collection mechanisms. The performance and accessibility cannot be fully assessed due to the minimal content. Security posture is weak due to absence of HTTPS, security headers, and privacy compliance indicators. The domain registration is consistent and legitimate, but the website itself does not demonstrate operational maturity or trustworthiness. There are no signs of WAF or security blocking mechanisms. Overall, the website is non-functional and presents critical issues that severely limit its usability, security, and compliance. Strategic recommendations include enabling HTTPS, deploying actual website content, adding privacy and cookie policies, and implementing security best practices to improve trust and compliance.

15
25
-
75
-
70
100
404azureerrordomainnotconfigured
Microsoft Azure
2025-06-27T12:56:16.696Z
camphillschool.org.uk favicon

Camphill School Aberdeen

camphillschool.org.uk

0
EducationUnited KingdommediumMEDIUM

Camphill School Aberdeen is a charitable organization dedicated to supporting young people with learning disabilities and complex additional support needs in north east Scotland. With a history spanning approximately 80 years, the organization provides specialized education, residential care, workshops, therapies, and community transport services. The website reflects a well-established non-profit entity with a clear mission and sector-leading care reputation in its niche. Technically, the website is built on the Webflow platform, leveraging modern web technologies such as Google Tag Manager, Google Fonts, and reCAPTCHA for security and analytics. The site is mobile-optimized and presents a professional design with consistent branding. Security posture is generally good with HTTPS enforced and use of reCAPTCHA; however, explicit security headers and published security policies are lacking. Privacy compliance is partial, with a cookie consent banner present but no visible privacy policy or terms of service in the provided content. The WHOIS lookup failed due to domain naming issues, raising concerns about domain legitimacy or configuration, though the website content itself appears credible. Overall, the site demonstrates moderate digital maturity with room for improvement in privacy and security transparency.

30
83
17
85
57
60
100
educationcharitylearningdisabilitiessupportscotland+1 more
Webflow CMSGoogle Fonts (Oswald)Google Tag ManagerGoogle reCAPTCHA+2
2025-06-27T12:56:16.692Z
axxonsoft.com favicon

Axxonsoft LLC

axxonsoft.com

0
TechnologyN/alargeMEDIUM

AxxonSoft is a global leader specializing in intelligent video management systems (VMS), physical security information management (PSIM), and cloud-based video surveillance solutions. The company offers advanced AI-powered analytics, seamless IP camera integration, and comprehensive security management platforms targeting enterprises, security professionals, and integrators worldwide. Their business model centers on software development, licensing, and partner ecosystem expansion, positioning them strongly in the physical security technology market. Technically, the website demonstrates a mature digital infrastructure utilizing modern JavaScript frameworks (Vue.js), advanced analytics tools (Google Analytics, Microsoft Clarity, PostHog), and robust consent management (Cookiebot). The site is mobile-optimized, SEO-friendly, and employs security best practices such as HTTPS and reCAPTCHA for form protection. From a security perspective, the site maintains a solid posture with published vulnerability disclosure policies, GDPR compliance, and secure data collection mechanisms. No critical vulnerabilities or exposed sensitive data were detected. However, explicit security headers and a security.txt file could enhance transparency and incident response readiness. Overall, the website reflects a professional, trustworthy, and technically sound digital presence aligned with the company's market leadership. The absence of WHOIS data slightly reduces domain trust but is mitigated by strong business and security indicators. Strategic recommendations include enhancing security header implementation, publishing a security.txt file, and providing clearer data protection officer contact details to further strengthen compliance and trust.

15
65
27
85
75
85
100
psimvideomanagementsoftwarevmsvideoanalyticvideosurveillance+8 more
Google AnalyticsGoogle Tag ManagerMicrosoft ClarityPostHog+5
2025-06-27T12:56:16.670Z
M

Marksmen Brand Protection Services

marksmen.com

0
OtherUnited StatesmediumMEDIUM

Marksmen Brand Protection Services is a specialized firm providing intellectual property investigations, acquisitions, and brand protection services globally. The company targets brand owners, legal professionals, marketing agencies, and corporate leadership with a comprehensive suite of services including trademark investigations, on-site investigations, discreet purchases, and market research. The website reflects a mature business with a professional online presence and a broad international client base. Technically, the site is built on WordPress with the Divi theme and integrates multiple marketing and analytics tools such as Google Analytics, HubSpot, and Hotjar, indicating a modern digital infrastructure. Security posture is solid with HTTPS enforced and use of reCAPTCHA on forms, though explicit security headers could be improved. Privacy and cookie policies are present with consent mechanisms, supporting GDPR compliance. However, the absence of WHOIS registration data raises concerns about domain legitimacy, which impacts overall trust. Strategic recommendations include enhancing security headers, publishing a security policy, and verifying domain registration details to improve credibility and trust.

30
68
2
75
62
80
100
intellectualpropertybrandprotectiontrademarkinvestigationsipacquisitionsmarketresearch+1 more
WordPressDivi ThemejQueryGoogle Analytics+5

Partner Domains:

portal.marksmen.com
service
2025-06-27T12:56:16.655Z