Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 2502 of 2975|Showing 125051-125100 of 148737
wowevents.eu favicon

WOW EVENTS

wowevents.eu

0
OtherEstoniamediumHIGH

WOW EVENTS is an established Estonian event management company with over 23 years of experience, specializing in corporate events such as conferences, client events, large-scale festivals, and internal communications. The company positions itself as a trusted and professional partner in the Estonian market, offering comprehensive event planning and production services. Their website reflects a mature digital presence with a professional design, clear navigation, and extensive service descriptions targeting business clients in Estonia. Technically, the website is built on WordPress using the Divi theme and integrates multiple marketing and analytics tools including Google Analytics, Facebook Pixel, and MonsterInsights. The site is mobile-optimized and SEO-friendly, though accessibility features are basic. Security posture is good with HTTPS enforced, but explicit security headers are not clearly detected. No critical vulnerabilities or exposed sensitive data were found in the content. Privacy compliance is an area for improvement as no explicit privacy or cookie policies were found, and user tracking is extensive via multiple third-party services. The WHOIS data is not publicly available due to EURid privacy policies, which is common for .eu domains but reduces transparency. Contact information is clearly provided with company domain emails and phone numbers, and social media presence is strong across major platforms. Overall, the website and business appear legitimate and professional, with minor gaps in privacy compliance and WHOIS transparency. Strategic recommendations include adding comprehensive privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

15
10
17
75
52
80
20
eventmanagementestoniacorporateeventsmarketingconference+3 more
WordPressDivi ThemeGoogle AnalyticsFacebook Pixel+4
2025-06-25T17:07:50.643Z
sbam.org favicon

Small Business Association of Michigan

sbam.org

0
OtherUnited StatesmediumMEDIUM

The Small Business Association of Michigan (SBAM) is a well-established membership organization dedicated to supporting small business owners in Michigan. With a membership base exceeding 33,000, SBAM offers a comprehensive suite of services including business certifications, insurance products, advocacy, networking opportunities, and compliance resources. The website reflects a professional and consistent brand image, targeting small business owners seeking growth, compliance, and employee retention solutions. The organization positions itself as a premier resource and advocate for Michigan's small business community. Technically, the website is built on WordPress and leverages modern web technologies and plugins such as Yoast SEO Premium, Events Calendar Pro, and various analytics and marketing tools including Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag. The site is mobile optimized, accessible, and SEO-friendly, indicating a mature digital presence. Performance is moderate with room for optimization. From a security perspective, the site uses HTTPS with a good SSL configuration and employs secure forms. However, there is a lack of explicit security headers and no visible privacy or cookie policies with consent mechanisms, which are areas for improvement. The WHOIS data is unavailable due to a malformed request, but the website's content and social media presence strongly indicate legitimacy and trustworthiness. Overall, SBAM's website demonstrates a strong business and technical foundation with minor gaps in privacy compliance and security best practices. Addressing these gaps will enhance user trust and regulatory compliance.

15
35
47
65
52
75
100
michigansmallbusinesssmallbusinessresourcessmallbusinessadvocacysmallbusinessnetworking
jQueryYoast SEO PremiumPhoto Gallery PluginEvents Calendar Pro+5

Partner Domains:

member.sbam.org
service
2025-06-25T17:07:50.624Z
ajboggs.com favicon

A.J.Boggs & Company

ajboggs.com

0
TechnologyUnited StatesmediumMEDIUM

A.J. Boggs & Company is a technology solutions provider specializing in healthcare, government, and public sector markets. Their offerings include managed hosting, eligibility management engines, search engine technology, and data interface solutions designed to improve operational efficiency and compliance. The company targets organizations requiring HIPAA-compliant and scalable technology services. The website reflects a medium-sized enterprise with a professional online presence and a focus on B2B services. Technically, the website is built on WordPress with modern plugins such as Yoast SEO and HubSpot analytics, indicating a moderate level of digital maturity. The site is mobile-optimized and performs adequately, though there is room for improvement in accessibility and security headers. The presence of a cookie consent mechanism and privacy policy shows awareness of privacy compliance, though GDPR compliance is not explicitly confirmed. Security posture is generally good with HTTPS enforced and no visible sensitive data exposure. However, the lack of explicit security headers and incident response information suggests areas for enhancement. The absence of WHOIS registration data is a notable concern, potentially indicating privacy protection or recent domain registration, which slightly reduces trustworthiness. Overall, the website and business appear legitimate and professional, but improvements in transparency around security policies and domain registration details are recommended to strengthen trust and compliance.

85
68
17
80
72
85
100
technologyhealthcaregovernmentmanagedhostinghipaa+6 more
WordPress 6.8.1Yoast SEO pluginjQuery 3.7.0FontAwesome+2

Partner Domains:

ixn.com
partner
lifia.org
partner
2025-06-25T17:07:50.621Z
harku.ee favicon

Harku Vallavalitsus

harku.ee

0
GovernmentEstoniasmallMEDIUM

Harku Vallavalitsus operates the official municipal government website for Harku vald, a coastal municipality in Estonia near Tallinn. The website serves as a comprehensive portal providing residents and stakeholders with access to municipal information, public services, community news, planning documents, and e-services. The site is well-structured with extensive navigation menus covering various sectors such as social services, education, environment, and governance. The target audience primarily includes local residents and businesses within the municipality. The business model is that of a government entity providing public information and services online. Technically, the website is built on the Liferay portal platform, utilizing technologies such as jQuery, Google Analytics, Hotjar, and Font Awesome. The site is accessible on both desktop and mobile devices with good mobile optimization and responsive design. Performance is moderate, and SEO practices are adequately implemented with proper meta tags and structured navigation. However, the use of an outdated jQuery version presents a moderate security risk. From a security perspective, the website enforces HTTPS and includes some security headers, but lacks advanced security policies such as Content Security Policy or published incident response procedures. No cookie consent mechanism is present, which may impact GDPR compliance. Analytics tools like Google Analytics and Hotjar are used, indicating moderate user tracking. No critical vulnerabilities or blocking mechanisms were detected. Overall, the website demonstrates a solid business credibility and technical foundation appropriate for a local government portal. Key areas for improvement include updating JavaScript libraries, implementing cookie consent, publishing security and incident response policies, and enhancing privacy compliance measures. These steps will strengthen the security posture and regulatory adherence of the site.

15
10
2
85
42
70
100
governmentmunicipalityestoniapublicserviceslocalgovernment
jQuery 1.10.2Google AnalyticsFont Awesome 4.5.0Google Fonts (Roboto Slab, Open Sans)+3
2025-06-25T17:07:50.597Z
stockmanngroup.com favicon

Lindex Group Oyj

stockmanngroup.com

0
RetailFinlandlargeMEDIUM

Lindex Group Oyj is a Finnish multinational retail company operating primarily in the fashion and department store sectors through its two main divisions: Lindex and Stockmann. Lindex is a leading Nordic fashion brand with a strong presence in 17 countries and online sales in 34 countries, focusing on women's and children's apparel, lingerie, and cosmetics. Stockmann operates quality department stores and e-commerce platforms in Finland and the Baltic countries. The company targets consumers seeking quality fashion and lifestyle products, leveraging a multichannel retail business model combining physical stores and digital commerce. The website reflects a professional corporate presence with comprehensive investor relations and sustainability information. Technically, the website is built on WordPress 6.8.1 with modern web technologies including jQuery and Google Tag Manager. It employs a cookie consent mechanism compliant with GDPR and integrates analytics tools such as Google Analytics and ContentSquare. The site is mobile-optimized and accessible, with good SEO practices. However, no explicit security headers were detected in the HTML source, which could be improved to enhance security posture. Security-wise, the site enforces HTTPS and uses cookie consent for privacy compliance. There is no visible security policy or incident response contact information published, which are areas for improvement. The absence of WHOIS registration data for the domain is a notable anomaly that raises questions about domain legitimacy, despite the professional appearance and content of the website. Overall, the website is well-designed and functional, supporting the company's business objectives effectively. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and verifying domain registration details to strengthen trust and compliance.

85
68
17
60
-
80
100
retailfashione-commercecorporateinvestor-relations+2 more
WordPress 6.8.1jQuery 3.7.1Google Tag ManagerServiceform cookie consent+1

Partner Domains:

stockmann.com
subsidiary
lindex.com
subsidiary

+1 more partners

2025-06-25T17:07:50.579Z
Z

Zone Media OÜ

famulus.ee

0
TechnologyEstoniasmallHIGH

The website famulus.ee is currently a parked domain page managed by Zone Media OÜ, an Estonian domain registrar and hosting provider. The page informs visitors that the domain is registered but not linked to any hosting service and promotes Zone's web hosting packages in multiple languages. The business operates in the technology sector, focusing on domain registration and web hosting services, targeting domain owners seeking hosting solutions. The domain is mature, registered since 2010, and the registrant information aligns with the hosting provider, indicating legitimacy. Technically, the website is a simple static page built with standard HTML, CSS, and JavaScript. It is mobile responsive and provides basic user experience but lacks advanced SEO and accessibility features. Security headers are minimal, with a weak Content-Security-Policy allowing 'unsafe-inline' scripts, and DNSSEC is not enabled for the domain. No HTTPS configuration details are visible, but the domain status suggests it is active and likely supports HTTPS. From a security perspective, the site has a low security posture due to weak headers and lack of DNSSEC. No privacy, cookie, or terms of service policies are present, and no contact or incident response information is provided. There are no analytics or tracking scripts detected, indicating minimal user tracking. The absence of contact details and policies reduces privacy compliance and user trust. Overall, the site serves as a placeholder with basic information and links to Zone Media OÜ's hosting services. The risk is low as no sensitive data is collected or exposed, but the lack of security best practices and compliance documentation suggests room for improvement. Strategic recommendations include enhancing security headers, enabling DNSSEC, adding privacy and cookie policies, and providing clear contact information to improve trust and compliance.

15
25
17
65
-
85
20
domainparkinghostingzonemediaoestoniawebhostingpackages
HTML5CSS3JavaScript
2025-06-25T17:07:50.569Z
S

Statiiv OÜ

statiiv.com

0
OtherEstoniasmallHIGH

Statiiv OÜ operates a professional website focused on creative services including photography, quality calligraphy, and graphic design. The business targets individuals and organizations seeking artistic visual content, positioning itself as a small local creative service provider in Estonia. The website presents a clean, modern design with consistent branding and clear business identification through the company registration number. Technically, the website uses standard web technologies such as HTML5, CSS3, Google Fonts, and JavaScript. The site is moderately optimized for performance and mobile devices but lacks advanced SEO and accessibility features. No CMS or complex frameworks are detected, indicating a lightweight custom implementation. From a security perspective, the site does not exhibit advanced security measures such as security headers or documented policies. The email contact is obfuscated via JavaScript to reduce spam risk, and no forms collect sensitive data. However, the SSL status is unknown from the provided data, and no privacy or cookie policies are present, which are important for GDPR compliance. Overall, the website is functional and professional but would benefit from enhanced security practices, explicit privacy and cookie policies, and improved technical SEO and accessibility. The domain WHOIS data aligns well with the business information, supporting legitimacy and trustworthiness.

30
35
2
55
-
85
-
photographycalligraphygraphicdesigncreativeservicesestonia
HTML5CSS3Google Fonts (Montserrat)JavaScript
2025-06-25T17:07:50.558Z
ridgecap.eu favicon

Ridge Capital

ridgecap.eu

0
FinanceEstoniasmallHIGH

Ridge Capital AS is a small Estonian investment firm founded in 2010, specializing in active investing focused on emerging markets, particularly in Central and Eastern Europe, South Eastern Europe, and the Baltic countries. The company leverages over 25 years of team experience to pursue event driven trading and long-term value investments, maintaining portfolio liquidity through diverse financial instruments. The website reflects a professional and consistent brand presence with clear business descriptions and contact information, targeting investors interested in niche emerging markets. Technically, the website is built on WordPress using Elementor and enhanced with Yoast SEO and Weglot for multilingual support. The site is mobile optimized with good SEO practices and moderate performance. Security posture is solid with HTTPS enforced and cookie consent implemented, though it lacks advanced security headers and explicit security or incident response policies. No forms collecting personal data are present on the homepage, reducing immediate data protection concerns. Overall, the website demonstrates a mature digital presence with good privacy compliance and business credibility. Security practices are adequate but could be improved by adding security headers, incident response contacts, and vulnerability disclosure mechanisms. The domain registration is consistent with the business history and shows no suspicious indicators, supporting the legitimacy of the entity. Strategic recommendations include enhancing security headers, publishing a security policy, providing incident response contact details, and considering a vulnerability disclosure program to strengthen trust and compliance.

15
40
2
60
85
85
20
financeinvestmentemergingmarketswordpresselementor+2 more
WordPressElementorYoast SEOWeglot (translation)+2
2025-06-25T17:07:50.553Z
kim-johansen.com favicon

Kim Johansen International Transport A/S

kim-johansen.com

0
TransportationDenmarklargeMEDIUM

Kim Johansen International Transport A/S is a well-established European transportation company specializing in the delivery of time-sensitive goods. With over 45 years of experience, the company emphasizes efficient, secure, and environmentally responsible logistics solutions. Their market position is strong within the European transport sector, targeting businesses requiring reliable and precise delivery services. The website reflects a professional image with clear service offerings and contact information, supporting their credibility. Technically, the website employs modern JavaScript libraries such as jQuery, Bootstrap, and Revolution Slider, hosted on Microsoft Azure DNS infrastructure. The site is mobile-optimized and demonstrates good SEO practices. Cookie consent is managed via Cookiebot, indicating attention to privacy compliance. However, no explicit CMS or advanced frameworks are detected, and performance is moderate. From a security perspective, the site uses HTTPS and has domain transfer protections in place. However, DNSSEC is not enabled, and no explicit security headers were detected in the provided data. There is no public security policy or incident response information, which could be improved. The domain WHOIS data is consistent and supports legitimacy, with a long registration period and matching business claims. Overall, the website scores well in content quality, business credibility, and privacy compliance, with moderate technical and security posture scores. Strategic improvements in DNS security, security headers, and public security policies would enhance trust and resilience.

15
68
17
85
85
85
40
transportationlogisticstime-sensitivegoodseuropeantransportcookieconsent+2 more
jQueryBootstrapRevolution SliderSelect2+3
2025-06-25T17:07:50.434Z
traff.co favicon

TRAFF OÜ

traff.co

0
TechnologyEstoniamediumMEDIUM

TRAFF OÜ operates a sophisticated online marketing platform that connects advertisers and publishers through its proprietary AdExchange system. The company focuses on delivering targeted advertising solutions using advanced audience analytics, campaign optimization, and a variety of digital marketing tools. Positioned as a medium-sized technology company based in Estonia, TRAFF OÜ serves a global audience with a strong emphasis on quality traffic and conversion metrics. The website reflects a professional and consistent brand image with comprehensive service offerings and clear contact channels. Technically, the website employs modern web technologies including jQuery, Google Analytics, Yandex Metrika, and Google reCAPTCHA to ensure both functionality and security. The site is mobile-optimized and demonstrates good SEO practices, although some improvements in accessibility and security headers could enhance its posture. The presence of multiple analytics and tracking tools indicates a moderate level of user tracking balanced with privacy compliance measures. From a security perspective, the site uses HTTPS exclusively and integrates CAPTCHA for form submissions, reducing the risk of automated abuse. However, the absence of explicit security headers and incident response information suggests room for improvement in security maturity. The WHOIS data is privacy protected, which is common for this business type, and the website provides sufficient company information to establish legitimacy. Overall, TRAFF OÜ presents a credible and professional online marketing platform with a solid technical foundation and good privacy compliance. Strategic enhancements in security policies and transparency could further strengthen trust and resilience against emerging threats.

15
65
2
85
72
80
20
onlinemarketingadvertisingplatformadexchangedigitalmarketingtrafficmonetization+2 more
jQueryGoogle AnalyticsGoogle reCAPTCHAYandex Metrika+3

Partner Domains:

advertiser.traff.co
service
2025-06-25T17:07:50.340Z
dashbird.io favicon

Dashbird Inc.

dashbird.io

0
TechnologyUnited StatesmediumMEDIUM

Dashbird Inc. is a technology company specializing in serverless observability and troubleshooting solutions. Their platform offers agentless monitoring, error detection, and end-to-end visibility across cloud-native infrastructures, primarily targeting developers, DevOps, security teams, and architects working with serverless applications. Recognized as a Gartner Cool Vendor in observability, Dashbird serves thousands of users with a SaaS business model focused on usage-based pricing. The company is headquartered in San Francisco and has been operational since 2017. Technically, the website is built on WordPress and leverages a modern tech stack including Google Analytics, Google Tag Manager, Intercom, HubSpot Forms, Hotjar, and other marketing and analytics tools. Hosting is likely on AWS, supported by DNS records. The site demonstrates good SEO optimization, mobile responsiveness, and a professional design with clear navigation and rich content. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and does not publish a security policy or incident response contacts. No vulnerability disclosure or security.txt file is present. The domain registration is mature and consistent with the business claims, though the registrant country differs from the business address, likely due to registrar location or privacy. Overall, Dashbird presents a strong business and technical profile with good privacy compliance and trust indicators. Strategic recommendations include enhancing security headers, publishing a security policy, and adding vulnerability disclosure information to improve security posture and trust further.

70
83
17
70
57
65
100
serverlessmonitoringobservabilitycloudaws+3 more
Google AnalyticsGoogle Tag ManagerIntercomHubSpot Forms+4

Partner Domains:

capture.navattic.com
partner
www.iubenda.com
partner
2025-06-25T17:07:50.338Z
sparksocial.ee favicon

SPARK Social

sparksocial.ee

0
EducationEstoniasmallHIGH

SPARK Social operates an Estonian-based online social media training platform branded as SPARK PRO koolitus. The website offers a comprehensive social media course targeting individuals ranging from beginners to professionals, including social media specialists, marketers, and small business owners. The business model is centered on paid online education with scheduled live sessions via Google Meet, supplemented by Q&A with industry experts and access to recorded materials. The company leverages known social media strategists and creative professionals as instructors, enhancing credibility and market positioning within the education sector in Estonia. Technically, the website is built on WordPress with WooCommerce for e-commerce functionality, WPBakery Page Builder for layout, and Slider Revolution for visual content. It uses modern web technologies including jQuery, Google Fonts, and Font Awesome icons. Hosting and domain registration are managed by Zone Media OÜ, a reputable Estonian registrar. The site demonstrates good mobile optimization and moderate performance, though accessibility and SEO optimizations are basic. From a security perspective, the site enforces HTTPS and uses secure forms via Contact Form 7. However, it lacks visible security headers such as Content-Security-Policy and X-Frame-Options, which are recommended best practices. No vulnerabilities or exposed sensitive data were detected in the HTML content. Privacy compliance is weak due to the absence of a privacy policy and cookie consent mechanism, which poses a compliance risk under GDPR. Analytics usage includes Google Analytics, indicating moderate user tracking. Overall, the website is professionally designed and credible, with a clear business focus and consistent branding. The main risks relate to privacy compliance and security header implementation. Strategic improvements in these areas would enhance trust and regulatory adherence.

15
10
2
70
72
75
20
educationsocialmediaonlinetrainingestoniawordpress+1 more
WordPressWooCommerceWPBakery Page BuilderSlider Revolution+3
2025-06-25T17:07:50.327Z
E

Access Denied

ehealthinsurance.com

0
HealthcareN/alargeMEDIUM

The website ehealthinsurance.com is currently inaccessible due to a security block or Web Application Firewall (WAF) presenting an Access Denied page. This prevents any direct analysis of the website's content, metadata, or technical infrastructure. The domain is registered since 1998 with CSC Corporate Domains, Inc., indicating a mature and likely legitimate business presence in the healthcare insurance sector. However, the lack of accessible content limits the ability to assess the company's digital maturity, security posture, or privacy compliance. The security block suggests a protective measure to prevent unauthorized access or attacks, but it also restricts external analysis. From a technical perspective, no information about the technology stack, hosting, or performance can be derived. Similarly, no security headers, policies, or contact information are available for review. The WHOIS data is consistent and shows no privacy protection, which supports domain legitimacy. Overall, the site appears to be a large healthcare-related business with a long operational history, but the current security restrictions prevent a full evaluation. Security-wise, the presence of a WAF or similar mechanism is a positive indicator of protective measures, but the inability to verify security headers or policies is a limitation. No vulnerabilities or compliance gaps can be identified due to the blocked content. The overall risk assessment is constrained by the lack of data, and strategic recommendations focus on enabling secure but accessible information for external audits and transparency.

25
50
2
85
82
85
100
2025-06-25T17:07:50.303Z
T

Team Electric, LLC

teamelectric.net

0
EnergyUnited StatessmallHIGH

Team Electric, LLC is a family-owned electrical contracting company based in Denver, Colorado, with a strong local market presence serving the Denver metropolitan area and broader Colorado region. The company offers a wide range of commercial and industrial electrical services including general electrical work, new construction, remodels, data cabling, lighting systems, and specialized equipment services. Their website reflects a professional and trustworthy business with detailed leadership bios and certifications from recognized industry organizations, positioning them as a premier electrical contractor in their market. Technically, the website is built using standard web technologies including HTML5, Bootstrap CSS, and jQuery, hosted on InMotion Hosting. The site is mobile responsive with good navigation and content quality, though performance is moderate and accessibility features are basic. There is no evidence of a CMS or advanced platform usage. SEO optimization is basic with standard meta tags but no advanced structured data or Open Graph tags detected. From a security perspective, the site lacks visible security headers and there is no confirmation of HTTPS usage in the provided data, which is a significant concern. The contact form includes a simple anti-spam question but no advanced security or privacy policies are present. The absence of privacy and cookie policies indicates compliance gaps, particularly with GDPR and other privacy regulations. WHOIS data shows a long-established domain with consistent registration details, supporting the legitimacy of the business. Overall, the website is functional and professional but requires improvements in security posture and privacy compliance to enhance trust and protect user data. Strategic recommendations include implementing HTTPS, adding security headers, publishing privacy and cookie policies, and enhancing form security. These steps will improve the site's security score and compliance standing, supporting business credibility and customer trust.

15
50
2
85
72
70
-
electricalcontractingcommercialelectricalindustrialelectricaldenvercolorado+1 more
HTML5CSS (Bootstrap)JavaScript (jQuery)
2025-06-25T17:07:50.223Z