Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 2746 of 2975|Showing 137251-137300 of 148713
pharmalundensis.se favicon

PharmaLundensis

pharmalundensis.se

0
HealthcareSwedensmallHIGH

PharmaLundensis is a Swedish pharmaceutical company specializing in the development of drugs that bind and excrete heavy metals such as mercury, lead, and cadmium from the human body. Their flagship product candidate, Phal-501, targets diseases linked to heavy metal toxicity including COPD, depression, and chronic fatigue syndrome. The company maintains a professional web presence with investor relations, project descriptions, and contact information clearly presented. The website is primarily in Swedish with English language support, targeting patients, investors, and healthcare professionals interested in novel pharmaceutical treatments. Technically, the website is built on WordPress with modern plugins including Yoast SEO, WPML for multilingual support, and MonsterInsights for Google Analytics tracking. The site is mobile optimized and uses HTTPS with a cookie consent mechanism compliant with GDPR principles. Performance is moderate with good SEO and accessibility basics in place. Security posture is solid with HTTPS enforced and no visible vulnerabilities or exposed sensitive data. However, the site lacks explicit security policies, incident response contacts, and vulnerability disclosure mechanisms, which are recommended for enhanced trust and compliance. Privacy compliance is partial due to absence of a dedicated privacy policy page. Overall, PharmaLundensis presents a credible and professional digital footprint consistent with a small but focused pharmaceutical company. Strategic improvements in privacy and security disclosures would strengthen compliance and user trust.

15
15
-
85
-
70
100
pharmaceuticalhealthcareheavymetalsdetoxificationsweden+3 more
WordPressYoast SEO pluginGoogle Analytics (MonsterInsights)jQuery+6
2025-06-18T08:56:12.147Z
norrkopingshamn.se favicon

Norrköpings Hamn

norrkopingshamn.se

0
TransportationSwedenmediumHIGH

Norrköpings Hamn is a prominent Swedish port operator focused on providing modern and sustainable port services. The company serves a broad range of national and international customers, offering key services such as break bulk, bulk, container and intermodal logistics, liquid bulk, project cargo, and terminal services. The website reflects a well-established business with a clear market position as one of Sweden's largest ports, emphasizing sustainability and customer engagement through events and interactive content. Technically, the website is built on WordPress using the Avada theme, incorporating modern JavaScript libraries such as jQuery, GSAP, and Swiper for enhanced user experience. It employs standard web technologies and integrates analytics tools like Google Analytics and Plausible, alongside a comprehensive cookie consent mechanism via the Complianz GDPR plugin. The site is mobile-optimized, accessible, and SEO-friendly, providing a professional and user-friendly interface. From a security perspective, the site enforces HTTPS and implements cookie consent, but lacks explicit security policy or incident response information. No critical vulnerabilities or exposed sensitive data were detected. The security posture is solid but could be enhanced by adding dedicated security policies and improving security headers. Overall, Norrköpings Hamn's website demonstrates a high level of professionalism, compliance with privacy regulations, and a strong business presence. Strategic recommendations include formalizing security policies, enhancing incident response readiness, and continuous monitoring of third-party scripts to maintain security and trust.

-
-
5
70
-
60
100
transportationportlogisticsswedensustainability+3 more
WordPressAvada ThemejQueryGSAP+5
2025-06-18T08:56:11.855Z
forsbergsfritidscenter.se favicon

Forsbergs Fritidscenter i Hyssna AB

forsbergsfritidscenter.se

0
TransportationSwedenmediumHIGH

Forsbergs Fritidscenter i Hyssna AB operates as a leading Swedish retailer specializing in motorhomes, caravans, and related recreational vehicles. With over 30 years of industry experience, the company offers a comprehensive range of new and used vehicles, financing options, insurance, service workshops, and accessories. Their market position is strong nationally, supported by multiple centers across Sweden and partnerships with recognized financing providers. The website reflects a professional and customer-focused business model targeting individuals and families interested in recreational vehicles. Technically, the site is built on WordPress with modern plugins and scripts, including WPBakery, Google Tag Manager, and CookieYes for consent management. The site is mobile-optimized, SEO-friendly, and incorporates security features such as Google reCAPTCHA and HTTPS encryption. Security posture is solid with no critical vulnerabilities detected, though some security headers could be enhanced. Privacy compliance is well addressed with clear policies and consent mechanisms. Overall, the website and business demonstrate a mature digital presence with good trust indicators and compliance adherence.

15
-
5
85
-
70
20
motorhomescaravansswedenrecreationalvehiclescamping+5 more
WordPress 6.8.1WPBakery Page BuilderjQueryGoogle Fonts+5

Partner Domains:

wasa-kredit.se
partner
nordea-finans.se
partner

+1 more partners

2025-06-18T08:56:11.765Z
M

McKesson Medical-Surgical

pssworldmedical.com

0
HealthcareUnited StatesenterpriseMEDIUM

McKesson Medical-Surgical operates as a leading distributor of medical supplies, durable medical equipment, surgical supplies, and medical lab supplies, targeting healthcare professionals and organizations primarily in the United States. The website reflects a mature enterprise with a comprehensive portfolio of products and services, including inventory management, distribution, lab management, and financial services. The company positions itself as a trusted partner in healthcare supply chain management, emphasizing quality, service, and operational efficiency. Technically, the website is built on WordPress with modern front-end technologies such as Tailwind CSS, Swiper.js, and integrates third-party services like Google Tag Manager and OneTrust for privacy compliance. The site demonstrates good mobile optimization, accessibility, and SEO practices, contributing to a positive user experience. Security-wise, the site enforces HTTPS, uses secure login forms with CSRF protection, and implements a cookie consent mechanism compliant with GDPR. No critical vulnerabilities or exposed sensitive data were detected. However, explicit security policies and incident response contacts are not published, representing an area for improvement. Overall, the website is professional, trustworthy, and well-maintained, with strong business credibility and compliance posture. Strategic recommendations include publishing detailed security policies, incident response information, and vulnerability disclosure mechanisms to further enhance trust and security transparency.

65
63
5
85
-
65
100
healthcaremedicalsuppliesdistributionpharmaceuticalsmedicalequipment+3 more
JavaScriptGoogle Tag ManagerOneTrust Cookie ConsentVidyard Video Player+3

Partner Domains:

mckesson.com
parent
portal.mms.mckesson.com
service
2025-06-18T08:56:11.520Z
frohe.se favicon

FROHE AB

frohe.se

0
ManufacturingSwedenmediumHIGH

FROHE AB is a Swedish company specializing in precision injection moulding and cleanroom manufacturing, primarily serving the Medical, Industrial, and Automotive sectors. The company is positioned as a leading supplier in Stockholm, offering services from product development and prototyping to contract manufacturing and assembly. Their certifications (ISO 13485, 9001, 14001) reinforce their commitment to quality and regulatory compliance. Technically, the website is built on the Squarespace platform, leveraging modern web technologies and providing a good user experience with mobile optimization and SEO best practices. However, the site lacks critical privacy and cookie policies, incident response information, and security headers, which are important for compliance and security posture. The site uses HTTPS but does not implement advanced SSL features like HSTS. Overall, the security posture is moderate but could be improved with better policy disclosures and security headers. The domain uses privacy protection, which is common but reduces transparency. No suspicious indicators were found, and the business information is consistent and professional. Strategic recommendations include adding privacy and cookie policies, implementing security headers, and providing incident response contacts to enhance trust and compliance.

25
-
5
75
-
65
100
manufacturingprecisionplasticscleanroominjectionmouldingisocertified
Squarespace CMSTypekit FontsSquarespace hosted video
2025-06-18T08:56:11.504Z
confidence.se favicon

Nordic LEVEL Group AB

confidence.se

0
OtherSwedenmediumHIGH

Nordic LEVEL Group AB is a Swedish company specializing in providing critical safety and security solutions across various sectors including critical infrastructure, real estate, industrial, public sector, transportation, events & hospitality, retail, and personal & family security. The company positions itself as a best-in-class full-service provider in the Nordic region, offering advisory, technology, and venture services to enable clients to live a levelled life. The website reflects a professional and consistent brand image with clear navigation and relevant content tailored to its target audience. Technically, the website is built on WordPress using the Enfold theme and integrates multiple analytics and marketing tools such as Google Analytics, Google Tag Manager, Facebook Pixel, LinkedIn Insight, and Matomo. The site employs cookie consent mechanisms compliant with GDPR, and uses Google reCaptcha to secure forms. Performance is moderate with good mobile optimization and basic accessibility features. From a security perspective, the site uses HTTPS and has implemented cookie consent controls, but lacks explicit security headers and published security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The domain registration is privacy protected, which is common and justified for business websites, and no suspicious patterns were found. Overall, the security posture is adequate but could be improved with additional security best practices and transparency. The overall risk assessment indicates a well-maintained and professional website with minor gaps in security policy transparency and technical security headers. Strategic recommendations include enhancing security headers, publishing security and incident response policies, and adding a vulnerability disclosure mechanism to strengthen trust and compliance.

65
15
5
70
-
65
20
securityconsultingtechnologynordiccriticalinfrastructure+4 more
WordPressEnfold ThemeYoast SEOGoogle Tag Manager+5
2025-06-18T08:56:11.484Z
adhoc.se favicon

Adhoc Systems AB

adhoc.se

0
TechnologySwedensmallHIGH

Adhoc Systems AB is a Swedish small-sized company specializing in digitalization services, focusing on IT system changes and workflow improvements for various sectors including healthcare and industrial production. The company operates from Lund, Sweden, and emphasizes confidentiality in its projects. The website content is professionally presented in Swedish, targeting businesses and organizations seeking digital transformation solutions. The company holds a Microsoft Partner certification and displays trust indicators such as association with Barncancerfonden and a Bisnode credit rating logo. Technically, the website uses a Bootstrap 3.2.0 framework with jQuery and Flexslider for UI components. However, it relies on legacy technologies such as the ga.js Google Analytics script and loads resources over unsecured HTTP, which negatively impacts security and performance. The site is mobile responsive but lacks advanced accessibility and SEO optimizations. No CMS or hosting provider information is evident. From a security perspective, the site lacks HTTPS enforcement and security headers, exposing it to potential risks. No privacy or cookie policies are present, indicating non-compliance with GDPR requirements. No incident response or vulnerability disclosure information is provided. The absence of secure forms and modern tracking practices further reduces the security posture. Overall, the website is functional and professional but requires significant improvements in security, privacy compliance, and technical modernization to enhance trust and protect user data. Strategic recommendations include migrating to HTTPS, implementing privacy and cookie policies, updating analytics tools, and adopting security best practices.

15
-
-
85
-
60
100
digitaliseringtechnologyconsultingswedenitservices
Bootstrap 3.2.0jQuery 1.10.2Google Fonts (Muli)Flexslider+1
2025-06-18T08:56:11.278Z
T

The London School of English Ltd

londonschool.com

0
EducationUnited KingdommediumMEDIUM

The London School of English Ltd is a well-established educational organization founded in 1912, specializing in English language training for adult learners. It offers a broad range of courses including General English, Business English, Legal English, exam preparation, and corporate training both online and in-person. The school holds a strong market position as the longest-established English language school in Britain, with excellent Trustpilot ratings and perfect British Council inspection scores, reflecting its commitment to quality education. Technically, the website employs a modern technology stack including Google Tag Manager, Facebook Pixel, Hotjar, HubSpot, and Stripe for payments, supported by a responsive and accessible design. The site is well-optimized for SEO and mobile devices, with comprehensive cookie consent management and multiple language support. Hosting appears to be on a reliable cloud platform, and performance is moderate. From a security perspective, the site enforces HTTPS, uses security headers, and integrates secure payment processing. It employs CSRF protection and bot management cookies, but lacks a dedicated security policy or incident response page. User tracking is extensive but managed with a clear cookie consent mechanism, indicating good privacy compliance. Overall, the website demonstrates a high level of professionalism, trustworthiness, and digital maturity. Strategic recommendations include publishing explicit security and incident response policies, enhancing accessibility further, and maintaining regular audits of third-party scripts to sustain security posture.

60
58
-
70
-
80
100
educationenglishlanguageschoolonlinecoursescorporatetraininglanguagelearning+2 more
HTML5CSS3JavaScriptGoogle Tag Manager+9

Partner Domains:

marketing.londonschool.info
partner
giantdigital.co.uk
partner
2025-06-18T08:56:11.167Z
G

Goodtech ASA

goodtech.no

0
EnergyNorwaymediumMEDIUM

Goodtech ASA is a well-established Nordic system integrator specializing in industrial automation, digitalization, and operational optimization across sectors such as energy, manufacturing, and renewables. With a history dating back to 1913, the company offers a comprehensive value chain from production to boardroom, serving a diverse industrial clientele. Their services include automation, robotisation, digital transformation, electrification, and cyber security, supported by a strong partner network and a focus on sustainable industrial solutions. Technically, the website leverages modern frameworks like React and Next.js, with Sanity CMS for content management, and integrates analytics tools such as Google Tag Manager and Plausible Analytics. The site is well-optimized for performance, mobile responsiveness, and accessibility, reflecting a mature digital presence. Security-wise, Goodtech employs HTTPS, robust security headers, and avoids exposing sensitive data, although it lacks a visible cookie consent mechanism and dedicated security policy pages. Overall, the company demonstrates a strong security posture and compliance with GDPR, supported by ISO certifications. The domain registration aligns with the company's Norwegian roots and long-standing market presence, reinforcing its legitimacy. Strategic recommendations include enhancing privacy compliance with explicit cookie consent, publishing security and incident response policies, and maintaining continuous security audits to uphold trust and compliance.

45
28
5
85
-
85
100
industrialautomationdigitalizationenergymanufacturingsystemintegration+3 more
ReactNext.jsSanity CMSGoogle Tag Manager+1

Partner Domains:

aveva.com
partner
abb.com
partner

+3 more partners

2025-06-18T08:56:11.153Z
logiq.no favicon

Logiq

logiq.no

0
TechnologyNorwaymediumMEDIUM

Logiq is a Nordic-based technology company specializing in managed EDI and e-invoicing services that streamline B2B interactions with customers, suppliers, and authorities. Positioned as a leading EDI service provider in the Nordic region with global reach, Logiq offers a suite of services including invoice sending and receiving, digital purchasing, order processing, and compliance solutions. Their platform emphasizes accessibility, compliance, security, and flexibility to meet diverse business needs. Technically, the website is built on the Webflow CMS platform, leveraging modern web technologies such as jQuery, Google Tag Manager, Hubspot, and Cookiebot for analytics, marketing, and privacy compliance. The site demonstrates good mobile optimization and moderate performance, with a professional design and clear navigation. From a security perspective, the site enforces HTTPS and employs cookie consent management via Cookiebot, indicating a strong privacy posture. However, explicit security policies and incident response contacts are not published, representing an area for improvement. No vulnerabilities or exposed sensitive data were detected. Overall, Logiq's website reflects a mature digital presence with strong business credibility and compliance adherence. Strategic recommendations include publishing detailed security and incident response policies, enhancing accessibility features, and maintaining regular audits of third-party scripts to sustain security and trust.

30
58
-
55
-
80
100
edie-invoicingb2bdigitalorderprocessingnordic+2 more
Webflow CMSjQueryGoogle Tag ManagerHubspot+3
2025-06-18T08:56:11.024Z
hubbstergroup.com favicon

Hubbster Group AB

hubbstergroup.com

0
OtherSwedenmediumHIGH

Hubbster Group AB is a Swedish company specializing in data-driven feedback systems focused on customer, employee, and market experience. They provide a combination of SaaS survey tools and consulting services to help businesses make informed decisions and improve their operations. The company targets B2B clients primarily in Sweden and positions itself as a leading provider in its market segment. Their website is professionally designed, mobile-optimized, and includes clear navigation and relevant content that highlights their key services and client base. Technically, the website uses a modern but straightforward technology stack including jQuery, Slick Slider, and HubSpot marketing and analytics tools. It is built on the WebbEss CMS platform and employs HTTPS with good SSL configuration. The site loads with moderate performance and includes accessibility and SEO best practices, although some accessibility features could be improved. The presence of HubSpot scripts indicates a mature marketing automation and analytics setup. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and published security policies or incident response contacts. No vulnerabilities or suspicious elements were detected in the HTML content. Privacy compliance is supported by a privacy policy and cookie consent mechanism, with GDPR compliance implied by the Swedish market focus and policy presence. Overall, the website presents a trustworthy and professional image with a solid business foundation. Security posture is adequate but could be enhanced by adding security headers and formal policies. The domain registration data aligns well with the business claims, supporting legitimacy. Strategic recommendations include improving security headers, publishing incident response information, and enhancing accessibility to further strengthen trust and compliance.

15
25
-
70
-
65
100
feedbackcustomerexperienceemployeesurveysmarketresearchconsulting+2 more
jQuery 3.5.1Slick SliderHubSpot scriptsCSS Vars Ponyfill (for IE support)
2025-06-18T08:56:10.906Z
msci.com favicon

MSCI Inc.

msci.com

0
FinanceUnited StatesenterpriseMEDIUM

MSCI Inc. is a leading global provider of data, analytics, and technology solutions designed to support investment decision-making across private assets, wealth management, sustainability, indexes, and risk management. The company targets investment professionals and asset managers, offering integrated tools and insights to enhance portfolio performance and risk assessment. MSCI maintains a strong market position with a comprehensive suite of services and a professional, user-friendly website that reflects its enterprise-level stature. Technically, the website leverages modern frameworks such as React and Next.js, with integrations for analytics and consent management including Google Tag Manager and OneTrust. The site demonstrates excellent performance, mobile optimization, and accessibility, supported by a robust content management system likely based on Adobe Experience Manager. Security best practices are observed with HTTPS enforcement, security headers, and no visible vulnerabilities. The security posture is strong, though explicit security policies and incident response contacts are not publicly detailed. Privacy compliance is well-managed with clear privacy and cookie policies and consent mechanisms. The website exhibits high professionalism and trustworthiness, supported by consistent branding and legal disclosures. Overall, MSCI's digital presence is mature and secure, supporting its business credibility and market leadership. Strategic recommendations include publishing detailed security policies and incident response information to further enhance transparency and trust.

50
63
5
85
-
85
100
sustainabilityprivateassetswealthriskclimate+3 more
ReactNext.jsGoogle Tag ManagerOneTrust+3
2025-06-18T08:56:10.774Z