Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 40 of 206|Showing 1951-2000 of 10254
yinger.dev favicon

Max Yinger

yinger.dev

0
TechnologyUnited StatessmallMEDIUM

The website yinger.dev is a personal professional portfolio for Max Yinger, a UI Engineer specializing in realtime 3D, interaction, and performance. The site showcases his skills and professional presence with links to GitHub, LinkedIn, Twitter, and YouTube. The business model is a personal portfolio aimed at technology professionals and UI/UX developers. The site is hosted on Vercel using a modern React and Next.js stack, delivering fast performance and good mobile optimization. However, it lacks formal privacy, cookie, and security policies, which are important for compliance and trust. From a security perspective, the site uses HTTPS with excellent SSL configuration and no visible vulnerabilities or exposed sensitive data. Security headers are not explicitly detected, and there is no published security or incident response policy. Analytics usage is minimal and handled via Vercel's own tools, with no aggressive tracking or advertising detected. The site content is safe for general audiences with no adult or questionable content. Overall, the website scores well on technical implementation and business credibility but scores low on privacy compliance due to missing policies. The domain WHOIS data is consistent with the website content and owner identity, indicating legitimacy. Strategic recommendations include adding privacy and cookie policies, implementing security headers, and publishing a vulnerability disclosure or security.txt file to enhance trust and compliance.

30
35
2
40
72
80
100
uiengineerrealtime3dperformanceportfolioreact+2 more
ReactNext.jsVercel AnalyticsVercel Speed Insights
2025-10-12T16:41:54.010Z
lindywealth.com favicon

Lindy Wealth LLC

lindywealth.com

0
FinanceUnited StatessmallMEDIUM

Lindy Wealth LLC is a small finance sector company specializing in flat-fee financial planning and wealth management services tailored for content creators, YouTubers, and online entrepreneurs. The business is positioned as a niche provider focusing on tax strategy, fee minimization, and diversified investing, targeting solopreneurs in the United States. The website content and structured data confirm a professional approach with a Certified Financial Planner (CFP®) leading the services. The domain registration is recent (2025) and consistent with the business claims, indicating a legitimate startup operation. Technically, the website is built using modern web technologies including the Remix framework, with a focus on responsive design and good user experience. However, the site lacks visible security headers and DNSSEC is not enabled, which are areas for improvement. No analytics or tracking scripts were detected, suggesting minimal user tracking. The site does not currently provide privacy or cookie policies, which is a compliance gap especially for GDPR considerations. From a security perspective, the site uses HTTPS (implied by the domain and modern setup), but lacks explicit security headers and incident response contact information. No forms or input fields were detected in the provided HTML snapshot, reducing immediate attack surface but also limiting user interaction. The absence of privacy and cookie policies and limited contact information reduce trust and compliance posture. Overall, the security posture is moderate but could be significantly improved with standard best practices. The overall risk assessment is moderate with no critical vulnerabilities detected but notable compliance and security policy gaps. Strategic recommendations include implementing privacy and cookie policies, enabling DNSSEC, adding security headers, and providing clear contact information for security incidents. These steps will enhance trust, compliance, and security maturity for Lindy Wealth.

30
35
2
60
52
80
100
financialplanningwealthmanagementtaxstrategycontentcreatorssolopreneurs+1 more
JavaScriptCSSHTML
2025-10-12T16:37:17.834Z
rmkinjurylaw.com favicon

The Law Office of Richard M. Kenny

rmkinjurylaw.com

0
OtherUnited StatessmallMEDIUM

The Law Office of Richard M. Kenny is a small, highly specialized personal injury law firm based in New York City, serving clients across multiple boroughs including Manhattan, Bronx, Brooklyn, Queens, and Nassau County. The firm emphasizes a client-focused approach with a strong track record of over $500 million recovered and more than 5,000 cases prepared for trial. Their services cover a broad range of personal injury and medical malpractice claims, positioning them as a top-rated legal service provider in the NYC market. Technically, the website is built on WordPress with modern plugins such as Gravity Forms for client intake and Yoast SEO for search optimization. The site demonstrates good mobile responsiveness, accessibility, and SEO practices. Security is well implemented with HTTPS and multiple security headers, though the absence of a visible cookie consent mechanism suggests room for improvement in privacy compliance. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, the lack of WHOIS data due to privacy protection slightly reduces transparency but is common for legal firms. Overall, the site is professional, trustworthy, and well-maintained, supporting the firm's market position. Strategically, the firm should enhance privacy compliance by implementing a cookie consent banner and consider publishing explicit security and incident response policies to further build client trust and meet regulatory requirements.

65
68
17
75
75
75
100
personalinjurylawyernyclegalservicesmedicalmalpractice+2 more
WordPressGravity FormsjQueryOwl Carousel+3
2025-10-12T15:34:51.341Z
martinezlawhouston.com favicon

The Martinez Law Firm - Houston DWI Lawyer

martinezlawhouston.com

0
OtherUnited StatessmallMEDIUM

The Martinez Law Firm is a specialized legal practice based in Houston, Texas, focusing on criminal defense and DWI cases. Led by attorney Herman Martinez, the firm boasts over 25 years of experience and a strong reputation in the Houston legal market. The firm targets individuals facing criminal charges in Houston and Harris County, offering personalized and client-driven legal services. Their market position is reinforced by numerous client testimonials, awards, and a high aggregate rating, positioning them as a trusted choice for criminal defense in the region. Technically, the website is built on WordPress using WPBakery Page Builder and NitroPack for performance optimization. It employs modern web technologies and is well-optimized for SEO and mobile devices, providing a fast and user-friendly experience. Security-wise, the site uses HTTPS with good SSL configuration but lacks some security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. WHOIS data is incomplete or unavailable, which slightly reduces domain trustworthiness, but the professional website and business signals mitigate this concern. Overall, the site demonstrates strong business credibility and technical maturity with room for improvement in privacy and security transparency.

15
58
2
70
52
75
100
lawyercriminaldefensedwihoustonlegalservices+1 more
WordPressWPBakery Page BuilderNitroPackGoogle Tag Manager+2
2025-10-12T15:34:06.226Z
egochi.com favicon

Egochi Digital Marketing Agency

egochi.com

0
TechnologyUnited StatesmediumMEDIUM

Egochi Digital Marketing Agency is a professional, award-winning digital marketing firm specializing in SEO, PPC, content marketing, social media marketing, web design, and online reputation management. The company positions itself as a data-driven, client-focused agency delivering measurable results and sustainable growth for businesses. Their market presence is supported by multiple certifications and strong client testimonials, indicating a reputable and established business. Technically, the website is built on WordPress with modern plugins and tools such as Yoast SEO, Google Analytics, and Contact Form 7. The site is well-structured, mobile-optimized, and uses HTTPS, but lacks some advanced security headers and explicit privacy/cookie policies. The contact form includes CAPTCHA to mitigate spam. Security posture is generally good with HTTPS and no visible vulnerabilities, but the absence of security headers and a published security policy reduces the overall security maturity. The missing WHOIS registration data is a notable anomaly that requires further investigation to confirm domain legitimacy. Overall, the website is professional and trustworthy from a business and content perspective, but improvements in privacy compliance and security best practices are recommended to enhance trust and regulatory adherence.

20
53
17
75
75
75
100
digitalmarketingseoppccontentmarketingsocialmedia+4 more
WordPress CMSYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+5
2025-10-12T15:33:56.176Z
davidhardawaylaw.com favicon

The Law Offices of David C. Hardaway

davidhardawaylaw.com

0
OtherUnited StatessmallHIGH

The Law Offices of David C. Hardaway is a specialized criminal defense law firm based in San Marcos, Texas, serving clients primarily in Hays County and surrounding Central Texas areas. The firm offers comprehensive legal defense services including DWI, drug crimes, violent crimes, and other serious criminal charges. The website is professionally designed with rich content, detailed FAQs, attorney profiles, case results, and client testimonials, positioning the firm as a reputable and trusted legal service provider in the region. The firm holds multiple industry recognitions and certifications, enhancing its market credibility. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Swiper.js, and uses Google Fonts and Google Tag Manager for analytics and tracking. The site employs HTTPS with good SSL configuration and includes spam protection via Google reCAPTCHA on its contact form. However, it lacks visible security headers and cookie consent mechanisms, which are recommended for improved security and privacy compliance. From a security perspective, the site shows good practices like HTTPS enforcement and no exposed sensitive data, but the absence of WHOIS data for the domain raises concerns about domain registration legitimacy. Despite this, the website content and structure strongly indicate a legitimate business operation. Overall, the site scores well on content quality, business credibility, and technical implementation but should address privacy compliance and security header improvements. Strategically, the firm should verify domain registration details, implement comprehensive privacy and cookie policies with consent mechanisms, and enhance security headers to strengthen trust and compliance. These improvements will support the firm's professional image and reduce potential risks related to privacy and security.

15
53
17
70
72
75
-
lawfirmcriminaldefensedwilawyersanmarcostexas+4 more
WordPressjQuerySwiper.jsGoogle Fonts+5

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:46.044Z
farmerclinecampbell.com favicon

Farmer, Cline & Campbell Personal Injury Lawyers

farmerclinecampbell.com

0
OtherUnited StatesmediumMEDIUM

Farmer, Cline & Campbell Personal Injury Lawyers is a well-established personal injury law firm based in Charleston, West Virginia, with nearly 30 years of experience and over 300 years of combined attorney experience. The firm specializes in a wide range of personal injury cases including vehicle accidents, catastrophic injuries, and wrongful death. They have a strong market position supported by numerous legal awards, certifications, and a large volume of positive client reviews. Their business model focuses on providing expert legal representation to injured individuals in West Virginia, offering free consultations and emphasizing client trust and success. Technically, the website is built on WordPress with modern performance optimizations such as NitroPack, and integrates popular tools like Gravity Forms and Google Analytics. The site is mobile-optimized, fast-loading, and professionally designed, providing an excellent user experience. Security posture is good with HTTPS and reCAPTCHA protections, though it lacks some advanced security headers and DNSSEC. Privacy compliance is limited due to the absence of explicit privacy and cookie policies. Overall, the website reflects a credible and professional legal service provider with strong business credibility but could improve privacy transparency and security hardening.

15
53
17
40
52
75
100
personalinjurylawyerlegalserviceswestvirginiacharleston+5 more
WordPressGravity FormsNitroPackGoogle Fonts+4
2025-10-12T15:33:41.008Z
fanninglawllc.com favicon

Fanning Law, LLC

fanninglawllc.com

0
OtherUnited StatessmallMEDIUM

Fanning Law, LLC is a well-established small law firm specializing in family law services in Southern Maryland, particularly La Plata and Charles County. Led by attorney William C. Fanning Jr., the firm offers comprehensive legal assistance in divorce, child custody, support, property division, and related family law matters, with additional practice areas in personal injury, criminal defense, and business law. The website reflects a professional and client-focused approach with detailed content, testimonials, and local expertise. Technically, the website is built on WordPress with modern libraries such as jQuery and Swiper, and integrates Google Fonts and Google Tag Manager for analytics. The site is mobile-optimized, accessible, and performs moderately well. Security measures include HTTPS and Google reCAPTCHA on forms, though security headers are not detected, and privacy compliance could be improved with explicit policies and cookie consent mechanisms. The security posture is solid with no visible vulnerabilities or exposed sensitive data, but the absence of WHOIS data and domain registration details introduces some uncertainty about domain legitimacy. However, the professional presentation and detailed business information mitigate these concerns. Overall, the site is trustworthy and serves its target audience effectively. Recommendations include enhancing privacy and cookie policies, implementing security headers, publishing incident response contacts, and regular security audits to maintain compliance and trust.

55
53
17
75
72
75
-
familylawdivorcelegalservicesmarylandlawyer+3 more
WordPressjQuery 3.7.1Swiper 6.5.4Google Fonts+2

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:20.723Z
mrlevelhead.com favicon

Mr. Level Head

mrlevelhead.com

0
OtherUnited StatessmallHIGH

Mr. Level Head is a small, local handyman and home repair service provider based in Spring Hill, Florida, serving Hernando and Pasco counties. The company offers a wide range of home repair services including door repair, electrical work, painting, drywall repair, furniture assembly, plumbing, and more. The website positions the business as reliable and detail-oriented, supported by multiple positive customer testimonials and local business listings such as BBB and Yelp. The business model is straightforward, charging by the job with flexible scheduling and a one-year labor warranty, targeting homeowners and residents in the local area. Technically, the website is built on WordPress using the Elementor page builder and related plugins, leveraging modern web technologies such as jQuery, Font Awesome, and Google Fonts. The site is hosted likely via GoDaddy, with a moderate performance profile and good mobile optimization. SEO is well addressed with proper meta tags, structured data (JSON-LD), and clear navigation. However, accessibility is basic and could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and DNSSEC. No privacy or cookie policies are present, indicating compliance gaps especially regarding GDPR. There is no visible incident response or vulnerability disclosure information. Analytics and tracking are implemented via Google Analytics, Ahrefs, and StatCounter, with moderate user tracking levels but limited privacy transparency. Overall, the website is professional and trustworthy for its business purpose but would benefit from enhanced privacy compliance, improved security headers, and clearer policies to strengthen user trust and regulatory adherence.

15
35
17
55
72
80
40
handymanhomerepairlocalbusinessspringhillflhomeservices+1 more
WordPressElementorElementor ProjQuery+3
2025-10-12T15:32:50.656Z
polar.sh favicon

Polar Software Inc.

polar.sh

0
TechnologyUnited StatessmallMEDIUM

Polar Software Inc. is a technology startup founded in 2022, providing modern payment infrastructure solutions tailored for the 21st century. Their platform offers comprehensive services including payments, usage and billing, customer management, and global merchant of record capabilities. Positioned as a developer-friendly SaaS solution, Polar targets software creators and SaaS companies seeking seamless monetization and compliance with tax regulations. The company has secured a $10M seed round and maintains an open source presence, enhancing its credibility and community engagement. Technically, Polar leverages modern web technologies such as React and Next.js, hosted likely on cloud platforms with Cloudflare DNS services. The website demonstrates excellent performance, mobile optimization, and SEO practices. Integration with Google Analytics and Stripe Connect indicates a mature digital infrastructure supporting analytics and payment processing. From a security perspective, the site enforces HTTPS and employs domain transfer protection. However, DNSSEC is not enabled, and explicit security headers are not clearly visible. The absence of a published security policy or incident response contact suggests room for improvement in transparency and readiness. No vulnerabilities or exposed sensitive data were detected in the analysis. Overall, Polar presents a professional, trustworthy online presence with strong business and technical foundations. Strategic recommendations include enhancing security headers, enabling DNSSEC, publishing security policies, and establishing a vulnerability disclosure program to further strengthen trust and compliance.

70
68
2
85
72
80
100
paymentsaasmerchantofrecordbillingsubscriptions+3 more
ReactNext.jsCloudflare DNSGoogle Analytics+1
2025-10-12T15:31:43.383Z
sgfcitizen.org favicon

Springfield Daily Citizen

sgfcitizen.org

0
MediaUnited StatessmallMEDIUM

Springfield Daily Citizen is a local online newspaper serving the Springfield, Missouri community with community-focused news, event listings, and opinion pieces. Established in 2021, it operates as a small media outlet with a business model centered on digital news delivery supported by advertising and subscriptions. The website is professionally designed using WordPress with the Newspack theme and integrates multiple third-party services for analytics and advertising. The company maintains an active presence on major social media platforms, enhancing its community engagement and reach. Technically, the website leverages a modern CMS infrastructure with SEO optimization and mobile responsiveness. The hosting and domain registration are consistent with a legitimate local business, registered through GoDaddy. Performance is moderate with good mobile optimization, though there is room for improvement in accessibility and security headers. The site uses HTTPS with a good SSL configuration but lacks DNSSEC. From a security perspective, the site follows basic best practices such as HTTPS and no exposed sensitive data. However, it lacks published privacy and cookie policies, security headers, and a vulnerability disclosure mechanism, which are areas for improvement. The extensive use of tracking and advertising scripts indicates a moderate to extensive user tracking level, but privacy compliance is currently poor. Overall, Springfield Daily Citizen presents a trustworthy and professional local news platform with a solid technical foundation but requires enhancements in privacy compliance and security transparency to strengthen its security posture and user trust.

30
58
25
55
52
80
100
localnewsspringfieldmomediaonlinenewspapercommunitynews+2 more
WordPressYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+7
2025-10-12T14:23:08.531Z
news-leader.com favicon

Springfield News-Leader

news-leader.com

0
MediaUnited StatesmediumMEDIUM

Springfield News-Leader is a regional news media outlet serving Springfield, Missouri, and surrounding areas. It operates under the parent company Gannett, a major media conglomerate. The website provides local news coverage, event reporting, and advertising services targeting the general public interested in regional news. The business model is primarily advertising-supported, leveraging multiple ad networks and analytics platforms to monetize content. The site maintains a consistent brand identity and good content quality appropriate for its audience. Technically, the website employs modern web technologies including Polymer web components, extensive JavaScript frameworks, and third-party integrations for advertising and analytics. The site is hosted on Gannett's CDN infrastructure, ensuring moderate to good performance and mobile optimization. SEO and accessibility practices are well implemented, contributing to a positive user experience. From a security perspective, the site enforces HTTPS, uses standard security headers, and integrates a consent management platform (OneTrust) for GDPR compliance. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of publicly available WHOIS data for the subdomain and lack of explicit security policy or incident response contacts are areas for improvement. Overall, the site demonstrates a mature security posture suitable for a media organization. The overall risk assessment is low, with recommendations focusing on enhancing transparency around security policies and incident response, as well as maintaining vigilance on third-party scripts and advertising technologies. The site is trustworthy, professionally managed, and compliant with privacy regulations, making it a reliable source of local news content.

40
100
35
90
62
80
100
newsmedialocalspringfieldgannett+3 more
JavaScriptPolymerWeb ComponentsOneTrust+14

Partner Domains:

gannett.com
parent
news-leader.com
service
2025-10-12T14:22:53.344Z
branco.com favicon

Branco Enterprises Inc.

branco.com

0
Real EstateUnited StatesmediumMEDIUM

Branco Enterprises Inc. is a well-established construction company operating primarily in the Midwest United States, with offices in Neosho and Springfield, Missouri. Founded in 1933, Branco offers a comprehensive range of construction services including general contracting, design-build, construction management, and pre-construction evaluations. The company positions itself as a leader in the regional construction industry, serving sectors such as education, healthcare, community, and commercial projects. Their website reflects a professional and modern digital presence, showcasing project portfolios, safety initiatives, and career opportunities. Technically, the site is built on WordPress with Elementor and integrates advanced tools such as Google Analytics, Google Maps API, and Facebook Pixel for marketing and analytics purposes. Security measures include HTTPS enforcement, reCAPTCHA on forms, and standard security headers, contributing to a strong security posture. However, the absence of a visible cookie consent mechanism and limited privacy compliance indicators suggest room for improvement in regulatory adherence. The WHOIS data for the domain is unavailable, likely due to privacy protection, which slightly reduces transparency but is common for businesses of this type. Overall, Branco Enterprises presents a credible and professional online presence with a solid foundation for further enhancing privacy and security compliance.

70
58
17
80
62
80
20
constructiongeneralcontractingdesign-buildmissouribrancoenterprises+4 more
WordPressElementorGravity FormsGoogle Maps API+3
2025-10-12T14:22:48.335Z
olsson.com favicon

Olsson

olsson.com

0
OtherUnited StateslargeMEDIUM

Olsson is a nationally recognized, employee-owned engineering and design firm specializing in infrastructure solutions across multiple sectors including energy, transportation, government, telecommunications, and water. The company positions itself as a top-10 data center engineering firm with a strong emphasis on community impact and sustainability. Their website reflects a mature digital presence with comprehensive service offerings and a clear focus on client engagement and recruitment. Technically, the website is built on the Webflow platform, leveraging modern web technologies such as Google Fonts, reCAPTCHA, Microsoft Clarity, and various marketing and analytics tools. The site is well-optimized for performance, mobile responsiveness, and accessibility, providing a seamless user experience. From a security perspective, the site enforces HTTPS and integrates CAPTCHA protections on forms, demonstrating good security hygiene. However, explicit security headers and a visible cookie consent mechanism are absent, and no dedicated security or incident response policies are published. The WHOIS data is missing, which raises some concerns about domain registration transparency but does not detract significantly from the overall trustworthiness given the professional site content. Overall, Olsson's website presents a strong business and technical profile with minor gaps in privacy compliance and domain registration transparency. Strategic improvements in security policy visibility and privacy mechanisms would enhance trust and compliance.

15
53
2
85
72
85
100
engineeringdesignemployee-ownedconsultinginfrastructure+5 more
Webflow CMSGoogle FontsGoogle reCAPTCHAMicrosoft Clarity+5
2025-10-12T14:22:43.313Z
verifone.cloud favicon

VeriFone Inc.

verifone.cloud

0
TechnologyUnited StatesenterpriseLOW

Verifone.cloud is a developer-focused portal operated by VeriFone Inc., a leading global payment solutions provider. The website offers comprehensive documentation, APIs, and integration tools for global eCommerce, in-person payments, petroleum payment solutions, and omnichannel payment services. It targets developers and businesses seeking to implement or manage payment processing solutions. The site is professionally designed, well-structured, and consistent with Verifone's corporate branding. Technically, the site is built on Drupal 10 CMS, employs Google Analytics and Google Tag Manager for analytics and marketing, and uses HTTPS with a secure domain registration. Mobile optimization and accessibility are good, though some security headers are not explicitly detected. The site lacks explicit security and incident response policies and does not implement a cookie consent mechanism despite having a cookie policy. From a security perspective, the site is reasonably secure with HTTPS and domain transfer protections but could improve by enabling DNSSEC and adding security headers. No vulnerabilities or exposed sensitive data were detected. The WHOIS data aligns well with the business profile, supporting legitimacy. Overall, the site scores well in business credibility and technical implementation but has room for improvement in privacy compliance and security posture. Strategic recommendations include enhancing security headers, implementing cookie consent, publishing security and incident response policies, and enabling DNSSEC to strengthen domain security and compliance posture.

85
68
17
70
100
85
100
paymentecommercedeveloperapidocumentation+4 more
Drupal 10Google Tag ManagerGoogle Analytics (gtag.js)

Partner Domains:

www.verifone.com
partner
2025-10-12T14:21:58.196Z
U

U.S. Social Security Administration

ssa.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Social Security Administration (SSA) operates the official government website www.ssa.gov, providing comprehensive information and online services related to Social Security benefits, Medicare, and related programs. The site serves a broad audience of U.S. residents and citizens seeking to manage their benefits securely and efficiently. The SSA maintains a strong market position as the primary federal agency responsible for social insurance programs, with a history dating back to 1935. Technically, the website is built on Drupal 10, leveraging modern web technologies and performance monitoring tools such as New Relic and Boomerang. It demonstrates excellent mobile optimization, accessibility, and SEO practices, ensuring a high-quality user experience. The site uses HTTPS exclusively and implements security best practices, including security headers and monitoring, contributing to a robust security posture. While WHOIS data is unavailable due to the nature of .gov domains, the domain's legitimacy is supported by its official government status and consistent branding. Privacy policies are comprehensive and GDPR compliant, although the site could enhance cookie consent mechanisms and publish dedicated incident response and vulnerability disclosure information. Overall, the SSA website is a highly professional, secure, and trustworthy platform critical to delivering essential government services. Strategic recommendations include improving transparency around data retention, implementing explicit cookie consent, and establishing formal vulnerability disclosure channels.

30
58
17
70
-
80
100
governmentsocialsecuritymedicarebenefitsusgovernment+3 more
Drupal 10Google Tag ManagerNew Relic Browser MonitoringBOOMR (Boomerang) performance monitoring+1
2025-10-12T14:19:57.813Z
cloud.gov favicon

U.S. General Services Administration

cloud.gov

0
GovernmentUnited StatesmediumLOW

Cloud.gov is a U.S. government-operated platform-as-a-service designed to enable federal agencies to deploy secure, compliant digital services efficiently. Developed and maintained by the General Services Administration's Technology Transformation Services, it offers modern application hosting, compliant federal public websites, and DevSecOps workspaces tailored for government needs. The platform is FedRAMP Moderate authorized, ensuring adherence to stringent federal security standards and compliance mandates. Its business model leverages Interagency Agreements to simplify procurement and accelerate deployment timelines for government teams. Technically, Cloud.gov employs a modern tech stack including Astro for static site generation, the U.S. Web Design System for accessibility and design consistency, and is hosted on Amazon Web Services. The site demonstrates excellent performance, mobile optimization, and accessibility. Analytics are implemented via the Digital Analytics Program and Google Tag Manager, though a cookie consent mechanism is absent. From a security perspective, Cloud.gov exhibits strong practices including HTTPS enforcement, continuous monitoring, vulnerability scanning, incident reporting, and alignment with NIST and Zero Trust frameworks. The platform's FedRAMP Moderate authorization and GSA affiliation provide high trust and legitimacy. Minor improvements include enabling DNSSEC, publishing a security.txt file, and adding explicit data protection officer contact details. Overall, Cloud.gov presents a highly professional, secure, and trustworthy government cloud platform with excellent content quality and technical implementation. The platform effectively balances compliance, security, and usability to serve federal agencies' digital transformation needs.

55
53
83
85
95
80
100
governmentcloudfedrampcomplianceplatform-as-a-service+4 more
Astro v5.13.7Google Fonts (Inter)USWDS (U.S. Web Design System)Google Tag Manager+2
2025-10-12T14:19:52.798Z
ontoplist.com favicon

OnToplist.com

ontoplist.com

0
MediaUnited StatessmallMEDIUM

OnToplist.com operates as a specialized online directory platform focusing on categorizing and listing blogs and local businesses primarily within the United States. The platform offers users an extensive, human-curated directory to discover quality blogs across various niches such as digital tech, health, law, and lifestyle, as well as local business listings including digital agencies, law firms, and other service providers. The business model includes paid listing options to enhance online visibility for businesses and bloggers. The website has been operational since 2006, positioning itself as a niche media directory with a focus on quality and user engagement. Technically, the website employs modern web standards including HTML5, CSS3, and JavaScript with AJAX-powered forms and search autocomplete features. It uses HTTPS with a valid SSL certificate ensuring secure data transmission. The site is mobile responsive and optimized for good user experience and SEO, although some accessibility features could be improved. The technical infrastructure appears moderate in performance with no evident CMS or hosting provider disclosed. From a security perspective, the site demonstrates good practices such as CSRF token implementation in forms and secure login mechanisms. However, it lacks explicit security headers and a cookie consent mechanism, which are important for GDPR compliance and enhanced security posture. The absence of WHOIS data for the domain raises concerns about domain registration transparency and trustworthiness, although the website content and structure suggest a legitimate business operation. Overall, OnToplist.com presents a professional and functional directory service with a solid content offering and user interface. The main risks relate to domain registration opacity and minor compliance gaps. Strategic improvements in security headers, privacy consent, and domain transparency would enhance trust and compliance.

25
53
17
65
52
75
100
blogdirectorybusinesslistingslocalbusinessesusbusinessesseo+3 more
HTML5CSS3JavaScriptFetch API+1
2025-10-12T14:18:36.615Z
bubble.io favicon

Bubble Group, Inc

bubble.io

0
TechnologyUnited StateslargeMEDIUM

Bubble Group, Inc operates bubble.io, a leading no-code platform that empowers users to build web and mobile applications using AI-powered visual editing tools. Founded in 2008 and based in the US, Bubble has established itself as a mature and reputable player in the no-code SaaS market, targeting developers, startups, and businesses seeking rapid app development without coding expertise. The platform supports native mobile app publishing and integration with AI models like OpenAI and Anthropic, positioning itself as a comprehensive solution for modern app creation. Technically, the website leverages a modern tech stack including JavaScript frameworks, Google Fonts, Stripe for payments, Segment Analytics, Hotjar, and other libraries to deliver a performant and user-friendly experience. Hosting and DNS are managed via Cloudflare and AWS Cloudfront, ensuring reliable delivery and security. The site is mobile-optimized and uses structured data for SEO enhancement. However, accessibility features are basic and could be improved. From a security perspective, the site enforces HTTPS and uses Cloudflare DNS with clientTransferProhibited domain status, indicating good domain security practices. Cookie consent is implemented, but explicit privacy policies, terms of service, security policies, and incident response information are not found in the provided content, representing areas for compliance improvement. No vulnerabilities or suspicious patterns were detected. Overall, bubble.io presents a professional, trustworthy, and technically sound platform with strong business credibility. Strategic recommendations include publishing comprehensive privacy and security policies, enabling DNSSEC, enhancing accessibility, and providing vulnerability disclosure mechanisms to further strengthen compliance and user trust.

60
53
17
85
47
85
100
no-codeaiappdevelopmentsaastechnology+2 more
JavaScriptGoogle FontsStripe.jsSegment Analytics+6
2025-10-12T14:18:31.470Z
sgfmuseum.org favicon

Springfield Art Museum

sgfmuseum.org

0
GovernmentUnited StatesmediumMEDIUM

The Springfield Art Museum website serves as the official online presence for a government-affiliated non-profit art museum located in Springfield, Missouri. The site provides information about exhibitions, classes, public programs, and museum expansion updates, targeting the general public and local community members interested in art and cultural activities. The business model is primarily government-supported with public engagement and donation facilitation. The website is moderately mature, having been established in 2013, and maintains consistent branding and trust indicators appropriate for a public institution. Technically, the website is built on the CivicPlus CMS platform and employs common web technologies such as jQuery, AlpineJS, Google Tag Manager, and Facebook Pixel for analytics and marketing. The site is mobile-optimized and accessible, with moderate performance. However, there is room for improvement in SEO and security configurations, particularly in enabling DNSSEC and implementing security headers. From a security perspective, the site uses HTTPS and anti-forgery tokens in forms, but lacks visible security headers and DNSSEC, which are recommended for enhanced protection. Privacy compliance is basic, with no explicit cookie consent mechanism or comprehensive privacy policy, which may pose compliance risks under GDPR. The domain registration is consistent and trustworthy, with no privacy protection, aligning with the public nature of the institution. Overall, the website is professional and trustworthy but would benefit from enhanced privacy and security measures to improve compliance and user trust.

40
35
2
60
72
85
100
museumarteducationgovernmentnon-profit+2 more
jQuery 2.2.4jQuery UI 1.14.1AlpineJS 3.14.1Google Tag Manager+3
2025-10-12T13:16:24.784Z
travefy.com favicon

Travefy, Inc.

travefy.com

0
HospitalityUnited StatesmediumMEDIUM

Travefy, Inc. is a well-established travel software company founded in 2012, specializing in providing integrated SaaS solutions for travel agents, agencies, tour operators, and related hospitality sectors. Their platform consolidates itinerary management, proposals, CRM, and marketing tools into a unified system designed to streamline travel business operations and enhance client engagement. With over 30,000 travel brands worldwide using their services, Travefy holds a strong market position supported by extensive supplier integrations and a dedicated support team. Technically, the website is built on modern web technologies including Webflow CMS, HubSpot, Mixpanel, and Google Tag Manager, hosted on AWS infrastructure. The site demonstrates excellent performance, mobile optimization, and SEO practices. Security is robust with HTTPS enforced, PCI-DSS compliance, and multiple security headers implemented. However, DNSSEC is not enabled, and there is no public security.txt or explicit incident response contact information. The security posture is strong with no detected vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance indicators. Business credibility is high, supported by consistent branding, customer testimonials, and trust signals such as PCI-DSS certification. Overall, Travefy presents a professional, secure, and user-friendly digital presence with a mature technical infrastructure and strong business legitimacy. Strategic recommendations include enabling DNSSEC, publishing a security.txt file, and enhancing transparency around incident response to further strengthen security and trust.

55
68
17
87
77
90
100
travelsoftwaretravelagentscrmitinerary+2 more
Webflow CMSHubSpot AnalyticsMixpanelGoogle Tag Manager+3
2025-10-12T13:15:44.461Z