Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 41 of 206|Showing 2001-2050 of 10256
ontoplist.com favicon

OnToplist.com

ontoplist.com

0
MediaUnited StatessmallMEDIUM

OnToplist.com operates as a specialized online directory platform focusing on categorizing and listing blogs and local businesses primarily within the United States. The platform offers users an extensive, human-curated directory to discover quality blogs across various niches such as digital tech, health, law, and lifestyle, as well as local business listings including digital agencies, law firms, and other service providers. The business model includes paid listing options to enhance online visibility for businesses and bloggers. The website has been operational since 2006, positioning itself as a niche media directory with a focus on quality and user engagement. Technically, the website employs modern web standards including HTML5, CSS3, and JavaScript with AJAX-powered forms and search autocomplete features. It uses HTTPS with a valid SSL certificate ensuring secure data transmission. The site is mobile responsive and optimized for good user experience and SEO, although some accessibility features could be improved. The technical infrastructure appears moderate in performance with no evident CMS or hosting provider disclosed. From a security perspective, the site demonstrates good practices such as CSRF token implementation in forms and secure login mechanisms. However, it lacks explicit security headers and a cookie consent mechanism, which are important for GDPR compliance and enhanced security posture. The absence of WHOIS data for the domain raises concerns about domain registration transparency and trustworthiness, although the website content and structure suggest a legitimate business operation. Overall, OnToplist.com presents a professional and functional directory service with a solid content offering and user interface. The main risks relate to domain registration opacity and minor compliance gaps. Strategic improvements in security headers, privacy consent, and domain transparency would enhance trust and compliance.

25
53
17
65
52
75
100
blogdirectorybusinesslistingslocalbusinessesusbusinessesseo+3 more
HTML5CSS3JavaScriptFetch API+1
2025-10-12T14:18:36.615Z
bubble.io favicon

Bubble Group, Inc

bubble.io

0
TechnologyUnited StateslargeMEDIUM

Bubble Group, Inc operates bubble.io, a leading no-code platform that empowers users to build web and mobile applications using AI-powered visual editing tools. Founded in 2008 and based in the US, Bubble has established itself as a mature and reputable player in the no-code SaaS market, targeting developers, startups, and businesses seeking rapid app development without coding expertise. The platform supports native mobile app publishing and integration with AI models like OpenAI and Anthropic, positioning itself as a comprehensive solution for modern app creation. Technically, the website leverages a modern tech stack including JavaScript frameworks, Google Fonts, Stripe for payments, Segment Analytics, Hotjar, and other libraries to deliver a performant and user-friendly experience. Hosting and DNS are managed via Cloudflare and AWS Cloudfront, ensuring reliable delivery and security. The site is mobile-optimized and uses structured data for SEO enhancement. However, accessibility features are basic and could be improved. From a security perspective, the site enforces HTTPS and uses Cloudflare DNS with clientTransferProhibited domain status, indicating good domain security practices. Cookie consent is implemented, but explicit privacy policies, terms of service, security policies, and incident response information are not found in the provided content, representing areas for compliance improvement. No vulnerabilities or suspicious patterns were detected. Overall, bubble.io presents a professional, trustworthy, and technically sound platform with strong business credibility. Strategic recommendations include publishing comprehensive privacy and security policies, enabling DNSSEC, enhancing accessibility, and providing vulnerability disclosure mechanisms to further strengthen compliance and user trust.

60
53
17
85
47
85
100
no-codeaiappdevelopmentsaastechnology+2 more
JavaScriptGoogle FontsStripe.jsSegment Analytics+6
2025-10-12T14:18:31.470Z
sgfmuseum.org favicon

Springfield Art Museum

sgfmuseum.org

0
GovernmentUnited StatesmediumMEDIUM

The Springfield Art Museum website serves as the official online presence for a government-affiliated non-profit art museum located in Springfield, Missouri. The site provides information about exhibitions, classes, public programs, and museum expansion updates, targeting the general public and local community members interested in art and cultural activities. The business model is primarily government-supported with public engagement and donation facilitation. The website is moderately mature, having been established in 2013, and maintains consistent branding and trust indicators appropriate for a public institution. Technically, the website is built on the CivicPlus CMS platform and employs common web technologies such as jQuery, AlpineJS, Google Tag Manager, and Facebook Pixel for analytics and marketing. The site is mobile-optimized and accessible, with moderate performance. However, there is room for improvement in SEO and security configurations, particularly in enabling DNSSEC and implementing security headers. From a security perspective, the site uses HTTPS and anti-forgery tokens in forms, but lacks visible security headers and DNSSEC, which are recommended for enhanced protection. Privacy compliance is basic, with no explicit cookie consent mechanism or comprehensive privacy policy, which may pose compliance risks under GDPR. The domain registration is consistent and trustworthy, with no privacy protection, aligning with the public nature of the institution. Overall, the website is professional and trustworthy but would benefit from enhanced privacy and security measures to improve compliance and user trust.

40
35
2
60
72
85
100
museumarteducationgovernmentnon-profit+2 more
jQuery 2.2.4jQuery UI 1.14.1AlpineJS 3.14.1Google Tag Manager+3
2025-10-12T13:16:24.784Z
travefy.com favicon

Travefy, Inc.

travefy.com

0
HospitalityUnited StatesmediumMEDIUM

Travefy, Inc. is a well-established travel software company founded in 2012, specializing in providing integrated SaaS solutions for travel agents, agencies, tour operators, and related hospitality sectors. Their platform consolidates itinerary management, proposals, CRM, and marketing tools into a unified system designed to streamline travel business operations and enhance client engagement. With over 30,000 travel brands worldwide using their services, Travefy holds a strong market position supported by extensive supplier integrations and a dedicated support team. Technically, the website is built on modern web technologies including Webflow CMS, HubSpot, Mixpanel, and Google Tag Manager, hosted on AWS infrastructure. The site demonstrates excellent performance, mobile optimization, and SEO practices. Security is robust with HTTPS enforced, PCI-DSS compliance, and multiple security headers implemented. However, DNSSEC is not enabled, and there is no public security.txt or explicit incident response contact information. The security posture is strong with no detected vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance indicators. Business credibility is high, supported by consistent branding, customer testimonials, and trust signals such as PCI-DSS certification. Overall, Travefy presents a professional, secure, and user-friendly digital presence with a mature technical infrastructure and strong business legitimacy. Strategic recommendations include enabling DNSSEC, publishing a security.txt file, and enhancing transparency around incident response to further strengthen security and trust.

55
68
17
87
77
90
100
travelsoftwaretravelagentscrmitinerary+2 more
Webflow CMSHubSpot AnalyticsMixpanelGoogle Tag Manager+3
2025-10-12T13:15:44.461Z
collette.com favicon

Collette: Vacations, Guided Tour Operator, Travel Packages

collette.com

0
HospitalityUnited StateslargeMEDIUM

Collette is a well-established guided tour operator based in the United States, offering a wide range of curated travel packages and vacation tours globally. The company targets travelers seeking immersive and feature-rich guided travel experiences, including small group explorations, cruising, faith-based journeys, and private tours. Their market position is strong, supported by extensive content, customer reviews, and active social media engagement. Technically, the website employs a modern technology stack including Bootstrap, FontAwesome, Swiper JS, and integrates multiple analytics and marketing tools such as HubSpot, Datadog RUM, Google Tag Manager, and Microsoft Clarity. The site is mobile-optimized, accessible, and SEO-friendly, providing a professional user experience. From a security perspective, the website enforces HTTPS and uses secure practices such as masked user input and Google reCAPTCHA. However, it lacks some security headers like Content-Security-Policy and X-Content-Type-Options, and does not publicly disclose security policies or incident response procedures. The WHOIS data for the domain is missing, which raises concerns about domain registration transparency and reduces trustworthiness despite the professional site presentation. Overall, the website is secure, professional, and compliant with privacy regulations, but the absence of WHOIS data and explicit security policies suggests areas for improvement in transparency and security posture.

65
80
2
80
72
85
100
travelguidedtoursvacationstouroperatorhospitality+1 more
Bootstrap 5FontAwesome 6.1.1Swiper JSVanilla LazyLoad+9
2025-10-12T13:14:33.078Z
rcl.com favicon

RCL Systems, Inc.

rcl.com

0
TechnologyUnited StatessmallMEDIUM

RCL Systems, Inc. is a Texas-based IT support and consulting firm specializing in managed IT services for businesses, primarily in Houston. The company positions itself as a premier provider of IT solutions, offering services such as network management, computer services, and tech support. Their website reflects a professional and business-focused approach, targeting organizations seeking reliable IT management to optimize their operations. Technically, the website is built on Joomla CMS with modern front-end frameworks like Bootstrap and jQuery. It employs security measures such as HTTPS encryption and Google reCAPTCHA to protect user interactions. Analytics are conducted via Microsoft Clarity, indicating a moderate level of digital maturity. However, the site lacks visible privacy and cookie policies, which are critical for compliance and user trust. From a security perspective, the site demonstrates good baseline practices but could improve by implementing security headers, publishing a security policy, and providing vulnerability disclosure information. The absence of WHOIS data for the domain raises some concerns about domain registration transparency, although the website content and business information appear legitimate and professional. Overall, RCL Systems presents a credible business front with room for enhancement in privacy compliance and security transparency. Addressing these gaps would strengthen their trustworthiness and regulatory adherence.

65
35
55
70
65
80
100
itsupportmanageditservicestechnologyhoustonbusinessservices
Joomla CMSBootstrap CSSjQueryGoogle reCAPTCHA+3
2025-10-12T13:14:07.398Z
filecoin.io favicon

Protocol Labs, Inc.

filecoin.io

0
TechnologyUnited StateslargeMEDIUM

Filecoin.io is the official website for Filecoin, a decentralized storage network developed by Protocol Labs, Inc., a US-based technology company founded in 2014. The platform offers a decentralized data storage marketplace, protocol, and cryptocurrency incentives to disrupt traditional centralized cloud storage. The website targets developers, storage providers, and clients seeking decentralized storage solutions, positioning itself as a leading open market alternative to centralized cloud services. Technically, the site is built using the Hugo static site generator, employs modern web technologies including WebGL for 3D visualizations, and uses JSON-LD structured data for SEO. The site is well-designed, mobile-optimized, and provides a rich user experience with clear navigation and professional branding. Security-wise, the site enforces HTTPS and uses domain transfer protection but lacks DNSSEC and security headers. There are no published privacy, cookie, or terms of service policies, nor explicit security or incident response information, which are gaps in compliance and transparency. Overall, the website is trustworthy and professional but would benefit from enhanced privacy and security disclosures.

30
35
2
85
72
80
100
decentralizedstorageblockchaincryptocurrencyfilestoragetechnology+1 more
Hugo static site generatorJavaScriptJSON-LD structured dataCSS+2

Partner Domains:

filfox.info
partner
beryx.io
partner

+3 more partners

2025-10-12T13:13:26.430Z
cmmc-roi.com favicon

BomberJacket Networks

cmmc-roi.com

0
GovernmentUnited StatesmediumMEDIUM

BomberJacket Networks is a specialized cybersecurity consulting firm focused on helping defense contractors achieve CMMC compliance to secure Department of Defense contracts. The company positions itself as an authorized C3PAO with over 20 years of cybersecurity experience and a strong emphasis on service-disabled veteran ownership. Their website features a sophisticated CMMC ROI calculator tool designed to help organizations understand the financial impact and investment required for compliance. The business targets small to large defense contractors and technology firms with tailored compliance solutions and ongoing support services. Technically, the website is built on modern frameworks including React and Next.js, hosted on Vercel, and incorporates Google Tag Manager for analytics. The site is well-optimized for performance, mobile responsiveness, and SEO, with clear navigation and professional design. Security posture is solid with HTTPS enforced and no visible vulnerabilities, though some security headers are missing and no explicit cookie consent mechanism is present. From a security and compliance perspective, the site demonstrates strong trust signals through certifications, partnerships, and detailed service offerings. However, the absence of WHOIS registration data for the domain introduces some uncertainty about domain legitimacy. No explicit incident response or vulnerability disclosure policies are published, which could be improved to enhance trust and compliance. Overall, BomberJacket Networks presents a credible and professional front for CMMC compliance consulting, with a strong technical foundation and business focus. Addressing minor security and privacy gaps and clarifying domain registration details would further strengthen their market position and trustworthiness.

30
53
67
70
72
75
100
cmmcroicalculatordodcontractscybersecuritycompliance+3 more
ReactNext.jsGoogle Tag ManagerRecharts (charting library)

Partner Domains:

bomberjacket.net
partner
portal.bomberjacket.net
service
2025-10-12T13:10:24.608Z
U

United States Office of Personnel Management

usajobs.gov

0
GovernmentUnited StatesenterpriseLOW

USAJOBS is the official employment website of the United States federal government, operated under the United States Office of Personnel Management. It serves as the primary portal for job seekers to find and apply for federal government positions across a wide range of career fields. The platform offers comprehensive services including job search, resume management, application submission, and career exploration tools tailored to veterans, students, federal employees, and the general public. The website is well-branded, consistent, and highly professional, reflecting its authoritative government status. Technically, USAJOBS employs modern web technologies such as HTMX for dynamic content, Google Tag Manager for analytics, and uses secure HTTPS connections with optimized performance and excellent mobile responsiveness. Accessibility features are well implemented, ensuring compliance with government standards. The site integrates multiple official government domains and resources, enhancing its ecosystem and user experience. From a security perspective, USAJOBS demonstrates a strong posture with enforced HTTPS, secure form handling, session management, and no visible vulnerabilities or exposed sensitive data. However, explicit security headers and a visible cookie consent mechanism could be improved. Privacy policies and terms of service are comprehensive and clearly linked, supporting regulatory compliance including GDPR. WHOIS data is limited due to privacy typical of government domains but does not detract from the site's legitimacy. Overall, USAJOBS is a highly credible, secure, and user-friendly government employment portal with strong trust indicators and a robust technical foundation. Strategic recommendations include enhancing visible security headers, implementing cookie consent, and publishing security incident response information to further strengthen trust and compliance.

75
53
47
100
75
80
100
governmentjobsfederalemploymentcareerusajobs+2 more
JavaScriptHTMXGoogle Tag ManagerUniversal-Federated-Analytics+1

Partner Domains:

www.opm.gov
partner
careers.bop.gov
partner

+1 more partners

2025-10-12T13:09:44.342Z
regulations.gov favicon

Regulations.gov

regulations.gov

0
GovernmentUnited StateslargeMEDIUM

Regulations.gov is an official U.S. government website designed to provide public access to federal regulations and enable public participation in the rulemaking process. It serves as a centralized platform for regulatory information, targeting the general public, government stakeholders, and businesses. The site uses modern web technologies such as Ember.js and integrates government analytics and Google services for tracking and bot prevention. However, the provided HTML snapshot shows minimal content, consistent with a single-page application architecture. From a security perspective, the site employs Google reCAPTCHA to mitigate automated abuse but lacks visible security headers and explicit privacy or cookie policies in the provided content. The WHOIS data is incomplete, missing registrar and registrant details, which reduces trust from a domain registration standpoint. Nevertheless, the .gov domain and the nature of the content strongly indicate legitimacy as a government-operated portal. Overall, the website demonstrates a moderate level of technical maturity and business credibility but would benefit from enhanced transparency regarding privacy, security policies, and contact information. The absence of WHOIS details is a notable gap but likely due to redaction or privacy measures common with government domains. Strategic improvements in security headers, policy disclosures, and accessibility would strengthen the site's trust and compliance posture.

70
35
2
70
100
60
100
governmentregulationspubliccommentsfederalcompliance
Ember.jsGoogle AnalyticsDigitalGov AnalyticsGoogle reCAPTCHA
2025-10-12T13:09:39.330Z
U

U.S. Social Security Administration

socialsecurity.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The website www.ssa.gov is the official online presence of the U.S. Social Security Administration, a federal government agency responsible for administering Social Security programs including retirement, disability, and Medicare benefits. The site offers a comprehensive range of services such as benefits estimation, application processing, status checking, and card replacement, targeting U.S. residents and citizens. It maintains a strong market position as the authoritative source for Social Security information and services. Technically, the site is built on Drupal 10 CMS and leverages modern web technologies including Google Tag Manager, New Relic for performance monitoring, and Boomerang for real user monitoring. The site demonstrates excellent mobile optimization, accessibility, and SEO practices, ensuring a high-quality user experience. Hosting details are not explicitly stated but are consistent with government hosting standards. From a security perspective, the site enforces HTTPS, uses security monitoring tools, and likely implements standard security headers, although explicit header details are not visible in the provided data. No vulnerabilities or exposed sensitive data were detected. Privacy and cookie policies are clearly presented, with GDPR compliance indicators, reflecting a mature privacy posture. Overall, the site scores highly on content quality, technical implementation, security posture, privacy compliance, and business credibility. The domain is a .gov domain, which is tightly controlled and indicative of legitimacy. WHOIS data is privacy protected as expected for government domains. There are no signs of malicious activity or suspicious content. Strategic recommendations include publishing explicit security headers, incident response contacts, and vulnerability disclosure information to further enhance trust and transparency.

30
58
17
70
100
85
100
governmentsocialsecuritybenefitsmedicaredisability+3 more
Drupal 10Google Tag ManagerNew Relic Browser MonitoringBOOMR (Boomerang) performance monitoring+2
2025-10-12T13:09:34.178Z
mymoney.gov favicon

Financial Literacy and Education Commission (FLEC)

mymoney.gov

0
GovernmentUnited StateslargeMEDIUM

MyMoney.gov is an official U.S. government website managed by the Financial Literacy and Education Commission (FLEC) under the U.S. Department of the Treasury. It provides comprehensive financial literacy resources, tools, and educational materials targeted at a broad audience including youth, educators, researchers, military families, and federal payment recipients. The site serves as a trusted source for financial empowerment and education, supporting informed financial decision-making across the United States. Technically, the website is built on Drupal 10 CMS and leverages modern web technologies including FontAwesome for icons, Google Analytics and Google Tag Manager for analytics, and Akamai Boomerang for performance monitoring. The site is mobile-optimized, accessible, and uses HTTPS with strong SSL configuration, ensuring secure and reliable user experience. From a security perspective, the site enforces HTTPS and anonymizes IP addresses in analytics, but lacks some advanced security headers and a cookie consent mechanism. No vulnerabilities or exposed sensitive data were detected. WHOIS data is incomplete, which is typical for government domains, but the .gov TLD and official branding strongly support legitimacy. Overall, the site demonstrates a strong security posture appropriate for a government informational resource. The overall risk is low, with recommendations to enhance privacy compliance by implementing cookie consent and publishing a vulnerability disclosure policy. Adding explicit security headers would further strengthen the security posture. The site is professionally designed, trustworthy, and serves an essential public service role.

55
58
25
70
95
80
100
financialliteracygovernmenteducationustreasuryfinancialempowerment+2 more
Drupal 10FontAwesomeGoogle AnalyticsGoogle Tag Manager+2
2025-10-12T13:09:23.755Z
congress.gov favicon

Library of Congress

congress.gov

0
GovernmentUnited StateslargeMEDIUM

Congress.gov is the official website of the U.S. Congress, managed by the Library of Congress. It provides comprehensive legislative data, including bills, resolutions, Congressional Records, committee information, and member profiles. The site serves a broad audience including researchers, students, government officials, and the general public, offering authoritative and educational resources on the legislative process. The business model is a government information service, positioning itself as the primary source for U.S. legislative information online. Technically, the website employs modern JavaScript libraries such as jQuery and Bootstrap, integrates mapping capabilities via ArcGIS API, and uses Adobe's Dynamic Tag Management for analytics. The site is well-structured, mobile-optimized, and accessible, with good SEO practices. Performance is moderate, reflecting the complexity and volume of data served. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, explicit security headers and a public security policy or incident response page are absent. The WHOIS data is incomplete, likely due to .gov domain registry policies, but the domain and content strongly indicate legitimacy. Privacy compliance is limited, with no visible privacy or cookie policies on the homepage. Overall, Congress.gov is a highly credible and authoritative government resource with strong content quality and technical implementation. Strategic improvements include publishing clear privacy and cookie policies, enhancing security headers, and establishing a vulnerability disclosure program to further strengthen trust and compliance.

55
35
17
70
65
80
100
governmentlegislationcongresslibraryeducation+1 more
JavaScriptjQueryBootstrapArcGIS JS API+2
2025-10-12T13:09:13.679Z
cdfifund.gov favicon

Community Development Financial Institutions Fund

cdfifund.gov

0
GovernmentUnited StatesmediumMEDIUM

The Community Development Financial Institutions Fund (CDFI Fund) is a U.S. government entity under the Department of the Treasury focused on fostering economic growth in distressed communities by supporting mission-driven financial institutions. The website serves as a comprehensive portal for information on certification, funding programs, training, awards, and research data related to community development finance. It targets financial institutions, community organizations, and stakeholders seeking to engage with or benefit from CDFI programs. Technically, the website is built on Drupal 10, leveraging modern analytics and performance monitoring tools such as Google Analytics, Google Tag Manager, and Boomerang. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Hosting appears to be government-managed with Akamai CDN integration, ensuring reliable performance. From a security perspective, the site enforces HTTPS and employs anonymized IP tracking in analytics. While explicit security headers are not fully confirmed, no vulnerabilities or exposed sensitive data were detected. The absence of a cookie consent mechanism and published incident response policy are areas for improvement. The WHOIS data is limited due to the .gov domain nature but aligns with the official government status, supporting high legitimacy. Overall, the site presents a professional, trustworthy, and well-maintained digital presence for the CDFI Fund, with recommendations to enhance privacy compliance and security transparency to further strengthen user trust and regulatory adherence.

55
58
2
70
85
80
100
governmentfinancecommunitydevelopmentcdfitraining+3 more
Drupal 10Google AnalyticsGoogle Tag ManagerYouTube iframe API+2
2025-10-12T13:09:08.669Z
treasurydirect.gov favicon

U.S. Department of the Treasury

treasurydirect.gov

0
GovernmentUnited StatesenterpriseMEDIUM

TreasuryDirect.gov is the official U.S. Department of the Treasury website providing electronic services for purchasing, managing, and redeeming U.S. Savings Bonds and other Treasury securities. It serves a broad audience including the general public, financial professionals, and government entities. The platform is the sole official channel for these financial instruments, positioning it as a critical government financial service with a strong market presence. The website offers comprehensive information, tools, and auction data to support users in managing their investments securely and efficiently. Technically, the site employs a modern technology stack including jQuery, Bootstrap, Google reCAPTCHA, and Google Tag Manager, ensuring a responsive and accessible user experience. The site is well-optimized for mobile devices and includes accessibility features. Hosting appears to be managed by or for the U.S. government, ensuring reliability and compliance with government standards. From a security perspective, TreasuryDirect.gov demonstrates a strong posture with enforced HTTPS, use of security headers, and bot protection mechanisms. No vulnerabilities or exposed sensitive data were detected. However, there is room for improvement in publishing explicit security policies, vulnerability disclosure programs, and cookie consent mechanisms to enhance compliance and transparency. Overall, TreasuryDirect.gov is a highly trustworthy, professional, and secure government website that effectively serves its mission. Strategic enhancements in privacy compliance and security transparency would further strengthen its position and user trust.

70
53
2
70
100
85
100
governmentfinancetreasurysavingsbondsmarketablesecurities+1 more
jQueryBootstrapGoogle reCAPTCHAGoogle Tag Manager+2

Partner Domains:

fedinvest.fiscal.treasury.gov
partner
slgsafe.fiscal.treasury.gov
partner

+3 more partners

2025-10-12T13:09:03.656Z
sigpr.gov favicon

U.S. Department of the Treasury

sigpr.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Department of the Treasury's website at home.treasury.gov is a comprehensive and authoritative government portal focused on providing services and information related to reporting fraud, waste, and abuse. It serves a broad audience including the general public, businesses, financial institutions, and government entities. The site offers multiple reporting options, consumer alerts, and links to inspector general hotlines, positioning itself as a primary resource for fraud-related concerns within the U.S. Treasury domain. Technically, the website is built on Drupal 10 and leverages modern web technologies including Google Analytics, Google Tag Manager, and the U.S. Web Design System (USWDS) for accessibility and responsive design. The site demonstrates good performance, excellent mobile optimization, and strong accessibility features, ensuring a positive user experience across devices. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes standard security headers. There are no visible vulnerabilities or exposed sensitive data. However, the site lacks an explicit cookie consent mechanism and a published terms of service page, which are areas for improvement in privacy compliance. The WHOIS data is restricted as expected for a government .gov domain, with no suspicious indicators, supporting the site's legitimacy. Overall, the website is a high-quality, trustworthy government resource with strong business credibility and technical implementation. Strategic recommendations include enhancing privacy compliance with cookie consent, publishing terms of service, and providing clear incident response contacts to further strengthen trust and security posture.

55
58
17
70
85
80
100
governmentfraudfraudreportingustreasuryscams+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerFontAwesome+1

Partner Domains:

oig.treasury.gov
partner
www.irs.gov
partner

+2 more partners

2025-10-12T13:08:58.646Z
tigta.gov favicon

U.S. Treasury Inspector General for Tax Administration

tigta.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Treasury Inspector General for Tax Administration (TIGTA) operates as an independent oversight body for the Internal Revenue Service (IRS), focusing on promoting integrity, efficiency, and detecting fraud, waste, and abuse within IRS programs. The website serves as an official communication channel to provide reports, investigations, and avenues for submitting complaints related to IRS operations. The site is positioned as a trusted government resource with a clear mission and audience comprising taxpayers, government officials, and stakeholders interested in tax administration oversight. Technically, the website is built on the Drupal CMS platform and leverages the U.S. Web Design System (USWDS) for consistent government styling and accessibility. It uses modern JavaScript libraries such as Slick Carousel and is supported by Akamai CDN services for performance and security. The site demonstrates good mobile optimization, accessibility, and SEO practices, although some improvements in cookie consent and security headers could enhance compliance and security posture. From a security perspective, the site enforces HTTPS and avoids exposing sensitive data. However, it lacks explicit security headers and a published vulnerability disclosure or incident response policy, which are recommended best practices for government websites. The WHOIS data is unavailable due to .gov domain restrictions, but the domain's official status and consistent branding strongly support its legitimacy. Overall, the site maintains a high trust level with minor areas for improvement in privacy compliance and security transparency. The overall risk assessment is low, with recommendations focusing on enhancing security headers, implementing cookie consent mechanisms, and publishing security policies to strengthen user trust and regulatory compliance.

30
58
17
70
95
85
100
governmentirsoversighttaxadministrationfrauddetectionustreasury
JavaScriptUSWDS (U.S. Web Design System)Slick CarouselAkamai (cdn/akam)+1

Partner Domains:

www.treasury.gov
partner
www.pandemicoversight.gov
partner

+1 more partners

2025-10-12T13:08:53.562Z
treas.gov favicon

U.S. Department of the Treasury

treas.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Department of the Treasury website serves as the official digital presence of the federal agency responsible for managing the nation's finances, economic policy, and financial security. It provides a broad range of services and information targeting the general public, businesses, financial institutions, and government entities. The site is well-branded, professionally designed, and offers comprehensive content including policy issues, data centers, services, and news updates. Technically, the website is built on Drupal 10 with integration of modern web technologies such as Google Analytics, Google Tag Manager, and the U.S. Web Design System (USWDS). It is hosted likely behind Akamai's CDN and performance monitoring tools, ensuring fast load times and good mobile responsiveness. Accessibility and SEO best practices are well implemented. From a security perspective, the site enforces HTTPS and uses secure analytics configurations. However, explicit security headers are not clearly visible in the HTML, and there is no publicly available security policy or incident response contact information. The absence of a cookie consent mechanism and vulnerability disclosure page are minor compliance gaps. Overall, the security posture is strong but could be improved with more transparency and user privacy controls. The domain WHOIS data is unavailable, which is typical for U.S. government domains that restrict public WHOIS information for security reasons. The domain is a subdomain of treasury.gov, confirming its legitimacy. No suspicious or malicious indicators were found. The website is safe for general audiences and does not contain any adult or questionable content.

55
58
17
70
85
80
100
governmentfinancetreasuryofficialdata+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerFontAwesome+2

Partner Domains:

treasury.gov
parent
treasurydirect.gov
partner

+1 more partners

2025-10-12T13:08:43.541Z
fincen.gov favicon

Financial Crimes Enforcement Network

fincen.gov

0
GovernmentUnited StateslargeMEDIUM

The Financial Crimes Enforcement Network (FinCEN) operates as a bureau within the United States Department of the Treasury, focusing on safeguarding the financial system from illicit activities such as money laundering and terrorist financing. It provides critical financial intelligence, regulatory guidance, and enforcement actions to financial institutions, law enforcement, and government agencies. The website serves as a comprehensive resource hub for these stakeholders, offering access to advisories, reporting requirements, and enforcement updates. The site’s market position is that of a key federal government entity with authoritative oversight in financial crime prevention. Technically, the website is built on Drupal 10, leveraging modern web technologies including Google Tag Manager, Akamai mPulse for performance monitoring, and Font Awesome for iconography. The site is well-optimized for mobile and accessibility standards, with fast loading times and clear navigation. Security best practices are observed with HTTPS enforcement and no visible vulnerabilities or exposed sensitive data. Analytics usage is moderate and privacy policies are comprehensive, though a cookie consent mechanism is not explicitly present. From a security perspective, the site demonstrates a strong posture with secure configurations and adherence to government standards. The WHOIS data is limited due to privacy protections typical for government domains, but the domain’s .gov TLD and consistent branding strongly support legitimacy. No critical vulnerabilities or suspicious patterns were detected. Overall, the site is trustworthy, professional, and well-maintained. The overall risk assessment is low, with recommendations to enhance transparency by publishing explicit security headers and implementing a visible cookie consent banner to improve privacy compliance. Strategic improvements in incident response disclosures and security policy visibility would further strengthen trust and compliance.

50
58
20
70
95
65
100
governmentfinancefinancialcrimesamllawenforcement+3 more
Drupal 10Google Tag ManagerFont Awesome 6Universal-Federated-Analytics+1
2025-10-12T13:08:38.531Z
bep.gov favicon

Bureau of Engraving and Printing

bep.gov

0
GovernmentUnited StateslargeMEDIUM

The Bureau of Engraving and Printing (BEP) is a U.S. government agency responsible for the production of United States currency and related services such as mutilated currency redemption and currency accessibility programs. The website serves as an official portal providing educational resources, public services, and access to currency-related products. It targets the general public, government entities, and visually impaired individuals, positioning itself as the authoritative source for currency production information. Technically, the website is built on Drupal 10, leveraging modern web standards and government design systems (USWDS). It integrates Google Analytics and Tag Manager for analytics while maintaining privacy through IP anonymization. The site is mobile-optimized, accessible, and well-structured, reflecting a mature digital infrastructure. From a security perspective, the site enforces HTTPS, uses official .gov domain credentials, and follows best practices in data protection. While explicit security headers are not fully visible in the HTML, the overall posture is strong with no exposed vulnerabilities or sensitive data. Privacy policies and vulnerability disclosure information are present, though incident response contacts could be more explicit. Overall, the website is trustworthy, professional, and compliant with government standards, providing a safe and informative experience. Strategic recommendations include enhancing security header implementation, adding explicit incident response contacts, and implementing a cookie consent mechanism to improve GDPR compliance.

55
58
35
70
85
80
100
governmentcurrencyengravingprintingustreasury+2 more
Drupal 10Google AnalyticsGoogle Tag ManagerUS Web Design System (USWDS)+1

Partner Domains:

www.ttb.gov
partner
www.fiscal.treasury.gov
partner

+3 more partners

2025-10-12T13:08:33.521Z
ttb.gov favicon

Alcohol and Tobacco Tax and Trade Bureau

ttb.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The Alcohol and Tobacco Tax and Trade Bureau (TTB) is a federal government agency under the United States Department of the Treasury responsible for regulating and enforcing laws related to alcohol and tobacco products. The website serves as an authoritative source for regulatory information, licensing, tax collection, and trade practices enforcement. It targets businesses in the alcohol and tobacco industries, government entities, and the general public seeking compliance guidance. The site is well-branded, professionally designed, and provides comprehensive content relevant to its mission. Technically, the website is built on Drupal 10 CMS, leveraging modern web technologies including Akamai CDN for performance, Google Tag Manager, Microsoft Clarity, and DigitalGov Analytics for user behavior tracking and analytics. The site demonstrates excellent mobile optimization, accessibility, and SEO practices, ensuring a positive user experience across devices. From a security perspective, the site enforces HTTPS with strong SSL configuration and implements key security headers to protect users. However, it lacks a dedicated security policy page, incident response contacts, and a vulnerability disclosure program, which are recommended for enhancing transparency and security posture. No critical vulnerabilities or exposed sensitive data were detected. Overall, the website is a trustworthy and authoritative government resource with a strong security baseline and good privacy compliance. Strategic improvements in security transparency and incident response readiness would further strengthen its posture.

55
58
17
70
85
80
100
governmentalcoholtobaccotaxtrade+2 more
Drupal 10Google Tag ManagerMicrosoft ClarityYouTube iframe API+2
2025-10-12T13:08:28.491Z
asta.org favicon

American Society of Travel Advisors

asta.org

0
HospitalityUnited StateslargeMEDIUM

The American Society of Travel Advisors (ASTA) operates a professional and comprehensive website serving as the leading global advocate for travel advisors. The site provides education, advocacy, resources, and networking opportunities to its members and the broader travel industry. The business model is membership-based, focusing on supporting travel advisors through events, certifications, and industry advocacy. The organization is well-established with a domain age of over 20 years, reinforcing its market position as a trusted industry leader. The website content is relevant, professionally presented, and targets travel professionals and consumers seeking travel advisory services. Technically, the website is built on ASP.NET Web Forms with Telerik UI components and uses ContentBuddy CMS. It integrates multiple analytics and marketing tools including Google Analytics, Google Tag Manager, Facebook Pixel, LinkedIn Insight Tag, and Microsoft Application Insights for telemetry. Hosting and DNS services are managed via Cloudflare, providing reliable infrastructure. The site demonstrates moderate performance and good mobile optimization, though accessibility features are basic. From a security perspective, the site enforces HTTPS and uses clientTransferProhibited domain status to prevent unauthorized transfers. However, DNSSEC is not enabled, and there is no visible Content Security Policy or security.txt file. Privacy compliance is weak due to the absence of explicit privacy and cookie policies or consent mechanisms. No incident response or vulnerability disclosure information is provided. Overall, the security posture is adequate but could be improved with enhanced DNS security and published policies. The overall risk assessment is moderate with no critical vulnerabilities detected. Strategic recommendations include enabling DNSSEC, publishing privacy and cookie policies with consent mechanisms, implementing a Content Security Policy, and providing clear security incident contacts. These improvements would enhance trust, compliance, and security maturity, supporting ASTA's reputation as a leading travel industry association.

70
88
17
75
42
80
100
traveladvocacyeducationmembershipevents+2 more
ASP.NET Web FormsTelerik UI controlsjQueryGoogle Tag Manager+4
2025-10-12T12:06:26.790Z
allianzpartners.com favicon

Allianz Partners

allianzpartners.com

0
OtherUnited StatesenterpriseMEDIUM

Allianz Partners is a global leader in specialty insurance, focusing on travel, tuition, event ticket, bankcard, and assistance services. The website presents a professional and consistent brand image aligned with the parent company Allianz SE. The business model centers on providing insurance products and technology solutions to partners and their customers in the US market. The site is well-structured with comprehensive product information, customer testimonials, and corporate details, targeting insurance partners and end customers. Technically, the website is built on Adobe Experience Manager CMS with modern JavaScript frameworks and includes GDPR-compliant cookie consent mechanisms. The site is mobile-optimized and uses embedded media and social media integrations. Performance is moderate with room for improvement in accessibility and security headers. Security posture is adequate with HTTPS and cookie consent but lacks explicit security policies and incident response information. No critical vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data for the domain is a concern but may be due to proxy registration or subdomain usage. Overall, the site demonstrates a mature digital presence with good privacy compliance and business credibility. Strategic recommendations include enhancing security headers, publishing security and incident response policies, adding vulnerability disclosure mechanisms, and improving accessibility compliance to strengthen trust and security culture.

80
85
2
40
85
75
100
insurancetravelinsurancespecialtyinsuranceallianzpartnerscorporate+8 more
JavaScriptjQueryAdobe Experience Manager (AEM)OneTrust (cookie consent)+2

Partner Domains:

www.allianz.com
parent
www.allianztravelinsurance.com
related
2025-10-12T12:06:16.769Z
U

University of California Office of The President

ucop.edu

0
EducationUnited StatesenterpriseMEDIUM

The University of California Office of The President (UCOP) website serves as the central administrative portal for the UC system, providing comprehensive information about academic affairs, finance, operations, external relations, civil rights, and health services. The site targets students, faculty, staff, government officials, and the public, positioning itself as a leading public university system administrative body. The content is professional, well-structured, and consistent with the branding of a major educational institution. Technically, the website employs a combination of legacy and modern technologies including jQuery, Bootstrap 2.3.2, Modernizr, and Google Analytics. While the site is accessible and performs moderately well, some technical debt is evident due to older framework versions and basic mobile optimization. Accessibility features are present but could be enhanced. SEO is basic but functional. From a security perspective, the site enforces HTTPS and uses secure analytics scripts but lacks explicit security headers and detailed security or incident response policies. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is partially met with a comprehensive privacy policy and terms of use, but no cookie consent mechanism is implemented despite tracking scripts. Overall, the website is trustworthy and legitimate, supported by consistent WHOIS data and domain registration aligned with the University of California system. Strategic recommendations include improving security headers, implementing cookie consent, enhancing mobile and accessibility features, and publishing explicit security policies to strengthen compliance and user trust.

50
53
2
80
77
85
100
educationuniversitygovernmentpublicinstitutionacademicaffairs+4 more
jQuery 3.7.1Bootstrap 2.3.2ModernizrGoogle Analytics+2

Partner Domains:

ucanr.edu
partner
senate.universityofcalifornia.edu
partner

+1 more partners

2025-10-12T12:05:56.711Z
C

City of Springfield, MO

springfieldmo.gov

0
GovernmentUnited StateslargeMEDIUM

The website www.springfieldmo.gov serves as the official digital portal for the City of Springfield, Missouri, providing residents, businesses, and visitors with access to government services, news, events, and community resources. The site is well-branded with official logos and maintains a consistent government identity. It targets a broad audience including local citizens and stakeholders, offering key municipal services and information. The business model is that of a government entity focused on public service and community engagement. Technically, the site is built on the CivicPlus CMS platform and utilizes a mix of JavaScript libraries including jQuery, jQuery UI, and AlpineJS, alongside Google Tag Manager and Microsoft Application Insights for analytics and telemetry. The site is mobile responsive and offers a moderate level of performance and accessibility, though some improvements could be made in accessibility and updating legacy libraries. From a security perspective, the site enforces HTTPS and implements anti-forgery tokens in forms, indicating attention to secure data handling. However, some security headers are not explicitly detected, and the use of an older jQuery version may pose risks if not patched. Privacy compliance is limited by the absence of clearly accessible privacy and cookie policies, which should be addressed to meet modern regulatory standards. Overall, the site is trustworthy and professional, with no signs of malicious or adult content. The domain is a .gov TLD, which inherently carries legitimacy, though WHOIS data is not publicly available as typical for government domains. Strategic recommendations include updating JavaScript libraries, enhancing security headers, publishing comprehensive privacy and cookie policies, and improving accessibility features to ensure compliance and user trust.

40
35
17
75
42
25
100
governmentmunicipalcityspringfieldmissouri+5 more
jQuery 2.2.4jQuery UI 1.14.1AlpineJS 3.14.1Google Tag Manager+2
2025-10-12T12:05:16.640Z
cventevents.com favicon

Cvent

cventevents.com

0
TechnologyUnited StatesenterpriseMEDIUM

Cvent is a leading enterprise software provider specializing in event management, marketing, and attendee engagement solutions. The company also offers sourcing platforms to help hotels win business, positioning itself as a key player in the event technology and hospitality sectors. The website reflects a mature digital presence with comprehensive content targeting event planners, marketers, and hospitality professionals. The platform supports in-person, virtual, and hybrid events, catering to a broad market segment. Technically, the website is built on Drupal 10 CMS and integrates multiple advanced marketing and analytics tools such as Adobe DTM, Marketo, Datadog RUM, RudderStack, and others. The site demonstrates strong digital maturity with fast performance, mobile optimization, and good SEO practices. Security measures include HTTPS enforcement, content security policies, and bot mitigation services, although explicit security policy documentation is absent. The security posture is robust with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR requirements. However, the absence of a dedicated security policy or incident response contact is noted. WHOIS data is not publicly available, likely due to privacy protection, but the website's professional presentation and trust signals support its legitimacy. Overall, Cvent's website is a secure, professional, and well-optimized platform that effectively supports its business objectives. Strategic recommendations include publishing explicit security and incident response policies and enhancing transparency around vulnerability disclosures to further strengthen trust and compliance.

85
88
17
60
-
70
100
eventmanagementsoftwaresaasmarketinghospitality+5 more
Drupal 10Adobe DTM Tag ManagerGoogle reCAPTCHAMarketo+7

Partner Domains:

hello.cvent.com
partner
cvent.chilipiper.com
partner
2025-10-12T12:02:34.090Z
K

Kansas Department Of Transportation

ksdot.gov

0
GovernmentUnited StateslargeMEDIUM

The Kansas Department of Transportation (KDOT) is a state government agency responsible for delivering comprehensive transportation services and infrastructure across Kansas. Their website serves as a central hub for residents, travelers, businesses, and partners to access information on road conditions, projects, safety programs, permits, and employment opportunities. The site emphasizes multi-modal transportation including aviation, rail, public transit, and bicycle/pedestrian infrastructure, reflecting a broad service scope. KDOT holds a strong market position as the authoritative transportation entity for the state, providing essential public services with a large operational scale. Technically, the website employs a modern technology stack including AngularJS, jQuery, and Slick Carousel, supported by a Vision CMS platform. It integrates Google Analytics and Akamai mPulse for performance monitoring and user analytics. The site demonstrates good mobile optimization, accessibility, and SEO practices, with clear navigation and professional design. However, some security headers are not explicitly present, and no cookie consent mechanism was detected, indicating areas for compliance improvement. From a security perspective, the site uses HTTPS and has implemented session timeout and XSS keyword filtering within its CMS. No critical vulnerabilities or exposed sensitive data were found. The WHOIS data is incomplete or unavailable, which is unusual for a .gov domain, but the official domain suffix and site content strongly support legitimacy. Overall, the security posture is solid but could benefit from enhanced header policies and published security policies. The overall risk assessment is low, with the site providing trustworthy, government-backed information and services. Strategic recommendations include implementing comprehensive security headers, adding explicit cookie consent for privacy compliance, publishing security and incident response policies, and maintaining regular audits of third-party libraries to mitigate vulnerabilities.

20
35
17
40
85
70
100
governmenttransportationpublicserviceskansasdot+2 more
AngularJSjQuerySlick CarouselGoogle Analytics (GA4)+2
2025-10-12T12:02:19.065Z
T

Tyler Technologies

tylertech.com

0
GovernmentUnited StatesenterpriseLOW

Tyler Technologies is an enterprise-level software and services provider specializing in public sector solutions tailored for government agencies and educational institutions. The company offers a broad portfolio including ERP, courts and public safety, health and human services, and transformative technologies such as cybersecurity and data insights. Recognized as a leader in the Gartner Magic Quadrant for Cloud-Based ERP for U.S. Local Government, Tyler Technologies holds a strong market position with a focus on delivering secure, efficient, and integrated software solutions to its target audience. The website infrastructure is built on a modern technology stack including DNN CMS, Bootstrap, jQuery, and integrates marketing and analytics tools like Marketo and Google Tag Manager. The site demonstrates good technical maturity with responsive design, SEO optimization, and moderate performance. Security best practices are observed with HTTPS enforcement, compliance certifications (CJIS, PCI, SOC, GDPR), and a dedicated security and compliance section. However, direct contact information is limited on the main site, and WHOIS data is unavailable, which slightly impacts trust. Overall, Tyler Technologies exhibits a strong security posture and business credibility with comprehensive compliance frameworks and client support mechanisms. The absence of WHOIS transparency is a minor concern but is mitigated by the company's established market presence and external trust signals. Strategic recommendations include enhancing contact transparency, publishing security.txt, and improving accessibility compliance to further strengthen trust and security culture.

55
65
55
85
77
90
100
publicsectorgovernmentsoftwareeducationsoftwarecybersecuritycompliance+2 more
jQueryjQuery UIBootstrapMarketo Munchkin+4

Partner Domains:

investors.tylertech.com
partner
2025-10-12T12:02:09.047Z
treasury.gov favicon

U.S. Department of the Treasury

treasury.gov

0
GovernmentUnited StatesenterpriseMEDIUM

The U.S. Department of the Treasury website serves as the official digital presence of the federal government agency responsible for managing the nation's finances, economic policy, and regulatory oversight. It provides comprehensive information on policy issues, financial data, services, and news relevant to the public, businesses, financial institutions, and government entities. The site is well-branded, professionally designed, and highly accessible, reflecting its authoritative status. Technically, the website is built on Drupal 10 CMS and leverages modern web technologies including Google Analytics, Google Tag Manager, and Akamai for performance monitoring. The site is optimized for mobile devices and accessibility, with clear navigation and structured content. Security is robust with HTTPS enforced and anonymized analytics tracking, though explicit security headers and cookie consent mechanisms could be improved. From a security and compliance perspective, the site demonstrates strong adherence to best practices expected of a government entity, with no visible vulnerabilities or exposed sensitive data. However, the absence of explicit security policies, incident response information, and vulnerability disclosure mechanisms suggests areas for enhancement. The incomplete WHOIS data is a limitation but likely due to registry restrictions rather than malicious intent. Overall, the website is a trustworthy, authoritative source of government financial information with a strong security posture and high-quality user experience. Strategic improvements in privacy compliance and transparency would further strengthen its position.

55
58
17
70
85
80
100
governmentfinancetreasurypolicydata+5 more
Drupal 10Google AnalyticsGoogle Tag ManagerFontAwesome+2

Partner Domains:

www.ttb.gov
partner
www.bep.gov
partner

+3 more partners

2025-10-12T12:01:49.003Z
visualstudio.com favicon

Microsoft Corporation

visualstudio.com

0
TechnologyUnited StatesenterpriseLOW

Visual Studio, hosted at visualstudio.microsoft.com, is a flagship product of Microsoft Corporation, a leading global technology enterprise. The website offers comprehensive developer tools including an Integrated Development Environment (IDE) and code editor, targeting software developers across platforms and languages. Microsoft’s market position as a dominant technology provider is reinforced by the professional presentation and extensive service offerings visible on the site. The business model centers on providing software development tools and cloud integration services to a broad developer audience worldwide. Technically, the website is built on WordPress with the Avada theme and leverages modern web technologies such as jQuery, New Relic for performance monitoring, Microsoft Clarity for user behavior analytics, and Adobe Target for marketing optimization. The site is hosted likely on Microsoft Azure infrastructure, ensuring robust performance, excellent mobile optimization, and good accessibility standards. SEO and metadata are well implemented, including Open Graph and JSON-LD structured data for enhanced search engine visibility. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes multiple security headers to protect against common web vulnerabilities. Privacy compliance is robust, featuring a clear privacy policy, cookie consent mechanisms, and GDPR adherence. However, explicit security policies, incident response information, and vulnerability disclosure mechanisms are not publicly evident, representing areas for improvement. Overall, the website reflects a mature, secure, and professional digital presence consistent with Microsoft’s reputation. The absence of WHOIS data for the subdomain is expected and does not detract from legitimacy. Strategic recommendations include publishing explicit security and incident response policies, adding vulnerability disclosure information, and enhancing direct security contact channels to further strengthen trust and compliance.

70
88
17
78
80
90
100
softwaredevelopmentidecodeeditormicrosoftvisualstudio+3 more
WordPressAvada ThemejQueryNew Relic+6
2025-10-12T12:01:08.908Z