Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 293 of 516|Showing 14601-14650 of 25774
wrightclosebarger.com favicon

Wright Close & Barger, LLP

wrightclosebarger.com

0
OtherUnited StatessmallMEDIUM

Wright Close & Barger, LLP is a specialized Texas law firm focusing on complex civil litigation, including trial and appellate work. The firm has over 20 years of experience and is recognized for its appellate expertise, serving clients across Texas in areas such as personal injury, insurance, commercial disputes, intellectual property, and oil and gas. The website presents a professional image with clear branding and contact information, targeting legal clients seeking high-quality representation. Technically, the website is built on WordPress using the PaperStreet theme and incorporates modern JavaScript libraries such as jQuery, Slick Carousel, and Lozad for lazy loading. It uses Google Analytics and Google Tag Manager for tracking and SEO is enhanced with the Yoast SEO plugin. Hosting appears to be via WP Engine, a reputable managed WordPress host. The site is mobile optimized and performs moderately well, though accessibility features are basic. From a security perspective, the site enforces HTTPS and does not expose sensitive data or vulnerable libraries. However, it lacks important security headers and does not display cookie consent or privacy banners, which may impact compliance with privacy regulations. The absence of WHOIS data for the domain is a notable concern, reducing trust in domain legitimacy despite the professional website content. Overall, the site is a credible and professional legal services platform with room for improvement in privacy compliance and security hardening. The missing WHOIS data warrants further investigation to confirm domain ownership and legitimacy.

15
35
2
70
52
80
100
lawfirmlegalservicesappellateattorneystrialattorneystexas+1 more
WordPressjQueryGoogle AnalyticsYoast SEO+2
2025-07-07T10:08:51.381Z
klopp.law favicon

Klopp Law

klopp.law

0
OtherUnited StatessmallMEDIUM

Klopp Law is a veteran-owned criminal defense law firm based in Reading, Pennsylvania, specializing in defending clients against serious criminal charges such as drug offenses, gun cases, assaults, and DUI. The firm positions itself as a dedicated and aggressive advocate for clients in eastern Pennsylvania, emphasizing personalized legal representation and thorough case preparation. The website reflects a small but professional legal practice with a clear focus on criminal defense services. Technically, the website is built on WordPress using the PaperStreet theme framework, incorporating modern web technologies such as jQuery, Swiper.js for sliders, and lazy loading for images. SEO is well addressed with Yoast SEO plugin integration and proper meta tags. The site is mobile optimized and provides a good user experience with clear navigation and professional design. Hosting is likely through GoDaddy, consistent with the domain registrar information. From a security perspective, the site uses HTTPS and does not expose sensitive data in the HTML. However, it lacks DNSSEC, visible security headers, and dedicated security or incident response policies. Privacy compliance is weak due to the absence of privacy and cookie policies or consent mechanisms. The domain WHOIS data is consistent with the business claims, showing no privacy protection and a legitimate registration history. Overall, Klopp Law's website is a solid representation of a small legal practice with good business credibility and technical implementation but requires improvements in privacy compliance and security best practices to enhance trust and regulatory adherence.

15
35
2
70
52
75
100
legalcriminaldefenselawfirmpennsylvaniaveteran-owned+1 more
WordPressYoast SEO pluginjQuerySwiper.js+3

Partner Domains:

clients.clio.com
partner
app.clio.com
partner

+2 more partners

2025-07-07T10:08:46.369Z
mgwl.com favicon

McGill Gotsdiner Workman & Lepp P.C. L.L.O.

mgwl.com

0
OtherUnited StatesmediumMEDIUM

McGill Gotsdiner Workman & Lepp P.C. L.L.O. is a well-established Nebraska-based law firm specializing in corporate, business, estate planning, health care, employment, litigation, and real estate legal services. The firm targets entrepreneurs and businesses seeking comprehensive legal counsel and has been operating since 1975, positioning itself as a trusted regional legal service provider. The website reflects a professional and client-focused approach with detailed attorney profiles and multiple practice areas. Technically, the site is built on WordPress and leverages modern web technologies including Google Analytics, Google Tag Manager, and reCAPTCHA for security on contact forms. The site is mobile optimized and demonstrates good SEO practices with structured data markup. Security posture is solid with HTTPS enforced and use of CAPTCHA, though explicit security headers are not detected, and privacy compliance could be improved with cookie consent mechanisms. The absence of WHOIS registration data is a notable inconsistency that slightly impacts trust but does not overshadow the professional presentation and content quality. Overall, the website is a credible digital presence for a mid-sized law firm with room for enhancement in privacy and security transparency.

15
35
17
75
52
80
100
lawlegalcorporatebusinessestateplanning+5 more
jQueryGoogle AnalyticsGoogle Tag ManagerGoogle reCAPTCHA v3+2

Partner Domains:

www.lawfirmessentials.com
partner
www.paperstreet.com
partner
2025-07-07T10:08:41.355Z
crossandsmith.com favicon

Cross & Smith LLC

crossandsmith.com

0
OtherUnited StatessmallMEDIUM

Cross & Smith LLC is a well-established personal injury law firm operating primarily in Alabama with offices in Tuscaloosa and Birmingham. The firm specializes in accident and injury cases, boasting over 25 years of experience and significant verdicts and settlements exceeding $150 million. Their business model is client-focused with a contingency fee structure, targeting individuals seeking legal representation for personal injury matters. The website reflects a professional and consistent brand image with comprehensive service descriptions and client testimonials, supporting a strong market position in the regional legal services sector. Technically, the website is built on WordPress using a custom theme by PaperStreet, incorporating modern web technologies such as Yoast SEO for search optimization, Google reCAPTCHA for form security, and CallRail for call tracking. The site is mobile-optimized and provides a good user experience with clear navigation and relevant content. However, some accessibility features are basic and there is room for improvement in performance and security headers. From a security perspective, the site enforces HTTPS and uses reCAPTCHA to protect forms from spam. No critical vulnerabilities or exposed sensitive data were detected. However, the absence of explicit security headers like HSTS and CSP, and the lack of a published security or incident response policy, indicate areas for enhancement. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism or GDPR-specific disclosures. Overall, the website is trustworthy and professional, with a solid business credibility score. Strategic improvements in privacy compliance, security header implementation, and incident response transparency would further strengthen the firm's digital security posture and regulatory adherence.

15
35
17
70
42
75
100
personalinjurylawfirmlegalservicesalabamaattorneys+2 more
WordPressYoast SEOFontAwesomeGoogle reCAPTCHA+2
2025-07-07T10:08:16.290Z
randallmckinneylaw.com favicon

Law Office Randall H. McKinney

randallmckinneylaw.com

0
OtherN/asmallMEDIUM

The Law Office Randall H. McKinney operates as a small legal services provider specializing in trial law and personal injury cases in the Pittsburgh area. The website presents a professional image with clear navigation and detailed practice areas, targeting individuals seeking legal representation in personal injury and criminal defense matters. The business model is focused on providing specialized legal counsel with a local market position. Technically, the website employs common web technologies including Google Analytics and Google Tag Manager for tracking, and uses modern JavaScript libraries for UI elements. The site is moderately optimized for performance and mobile devices, with good SEO practices evident. However, no CMS or hosting provider information is discernible from the data. From a security perspective, the site uses HTTPS and avoids exposing sensitive data, but lacks visible security headers and does not provide privacy or cookie policies, which are important for compliance and user trust. The absence of WHOIS registration data is a notable concern, potentially indicating privacy protection or data unavailability, which impacts domain legitimacy assessment. Overall, the security posture is moderate but could be improved with better policy disclosures and security headers. The overall risk is moderate with recommendations to enhance privacy compliance, implement security best practices, and clarify domain registration details to improve trustworthiness and regulatory adherence.

20
35
2
70
77
60
100
legallawyerpersonalinjurytriallawyerpittsburgh+1 more
Google AnalyticsGoogle Tag ManagerFontAwesome
2025-07-07T10:07:31.117Z
sunsetblvdinv.com favicon

Sunset Blvd. Investigations Inc.

sunsetblvdinv.com

0
OtherUnited StatessmallMEDIUM

Sunset Blvd. Investigations Inc. is a small, privately owned private investigation firm based in Los Angeles, California, with an additional office in Newport Beach. Founded in 2015, the company leverages over 80 years of combined law enforcement and investigative experience from its founders, who served as detectives in the LAPD and LASD. The firm offers a comprehensive suite of investigative services including surveillance, background checks, litigation support, and executive protection, targeting individuals and businesses requiring professional investigative assistance locally and globally. The website is professionally designed, mobile-optimized, and provides clear navigation and detailed service descriptions, enhancing user experience and trust. Technically, the website is built on WordPress using a PaperStreet theme, employing modern web technologies such as jQuery and Google reCAPTCHA for form security. The site enforces HTTPS, ensuring secure communications, but lacks some recommended security headers which could improve its security posture. Privacy compliance is partially addressed with a comprehensive privacy policy, though cookie policy and consent mechanisms are absent. Contact information is prominently displayed with multiple phone numbers and physical addresses, supporting business credibility. Security-wise, the site demonstrates good practices such as HTTPS and CAPTCHA protection on forms, but could benefit from enhanced security headers and published incident response policies. The absence of WHOIS data for the domain is a notable concern, reducing domain trustworthiness despite the professional appearance and content of the website. Overall, the site presents a trustworthy and professional front for a specialized investigative service provider, with room for improvement in security and privacy transparency.

15
53
17
70
52
75
100
privateinvestigatorlosangelesinvestigationslawenforcementsurveillance+2 more
jQuery 3.7.1Font: Roboto WOFF2Slick SliderYoast SEO (implied by Yoast schema)+1
2025-07-07T10:07:00.960Z
nocowboys.co.nz favicon

NoCowboys Limited

nocowboys.co.nz

0
OtherNew ZealandmediumMEDIUM

NoCowboys Limited operates an online platform dedicated to connecting New Zealand residents with trusted tradespeople and businesses, including builders, mechanics, painters, and plumbers. The website serves as a comprehensive rating and review site, positioning itself as the original Kiwi rating platform with a substantial number of user-generated ratings. Its business model revolves around facilitating informed decisions for consumers and providing marketing support for businesses through reputation management and job posting services. Technically, the website employs a modern JavaScript stack including jQuery, Google Tag Manager, Facebook SDK, and Google reCAPTCHA to enhance user interaction and security. The site is mobile-optimized with good SEO practices and a professional design, although accessibility features are basic. Performance is moderate, and the site uses HTTPS, but lacks some advanced security headers. From a security perspective, the site benefits from HTTPS and reCAPTCHA integration but lacks explicit security policies, incident response contacts, and cookie consent mechanisms, which are important for compliance and user trust. The absence of WHOIS data for the domain raises concerns about domain legitimacy and registration transparency, impacting overall trustworthiness. Overall, NoCowboys presents a professional and trustworthy front for its business niche but should address privacy compliance and security best practices to enhance user confidence and regulatory adherence.

30
35
17
70
65
65
100
tradespeoplebusinessreviewsnewzealandbuildersplumbers+4 more
jQueryjQuery UIGoogle Tag ManagerFacebook SDK+2
2025-07-07T07:54:35.959Z
S

Sitetech Solutions Ltd T/A SiteName

certified.co.nz

0
OtherNew ZealandsmallMEDIUM

The website certified.co.nz currently serves a default cPanel hosting placeholder page indicating that the site is not configured or has been moved. The domain is registered to Sitetech Solutions Ltd T/A SiteName, a hosting provider based in New Zealand, with a domain age dating back to 2000. There is no active business content, marketing information, or services presented on the site. The only contact information is a webmaster email address at the domain. From a technical perspective, the site uses Apache and cPanel technologies with DNS hosted on Cloudflare name servers. The page is basic and minimally optimized for mobile devices, with no detected CMS or advanced frameworks. There are no scripts, analytics, or tracking technologies present. Performance is moderate but limited by the lack of actual content. Security posture is weak due to the absence of HTTPS enforcement and security headers. The site exposes a default placeholder page which may leak information about server configuration. No privacy, cookie, or terms of service policies are present, indicating poor compliance with data protection regulations. No incident response or vulnerability disclosure information is available. Overall, the site represents an inactive or misconfigured domain with low trustworthiness and minimal business credibility. Strategic recommendations include properly configuring the website with HTTPS, removing default placeholder pages, implementing security best practices, and publishing privacy and cookie policies to improve compliance and user trust.

15
50
2
70
75
60
100
defaultpagehostingplaceholdercpanelsitemisconfiguration
ApachecPanelCloudflare DNS
2025-07-07T07:54:25.943Z
hunton.com favicon

Hunton Andrews Kurth LLP

hunton.com

0
OtherUnited StateslargeMEDIUM

Hunton Andrews Kurth LLP is a well-established global law firm with over 120 years of history, serving clients primarily in the energy, financial services, real estate, and retail sectors. The firm operates through 18 offices worldwide and employs over 900 professionals. Their business model focuses on providing comprehensive legal services with a collaborative approach, targeting corporate clients and industries requiring specialized legal expertise. The website reflects a mature digital presence with professional design, clear navigation, and extensive content that supports their market position as a leading law firm. Technically, the website employs modern web technologies including Google Tag Manager for analytics and OneTrust for cookie consent management, indicating a commitment to privacy compliance and user experience. The site is mobile-optimized, accessible, and SEO-friendly, though no specific CMS or hosting provider was identified. Performance is moderate, with good use of modern image formats and SVG graphics. From a security perspective, the site uses HTTPS with strong SSL configuration and includes security headers, enhancing protection against common web threats. However, there is no publicly available security policy or incident response information, nor a vulnerability disclosure program, which could be areas for improvement. No vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong, with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low-risk profile with high business credibility and professionalism. The absence of WHOIS data for the exact www.hunton.com domain is noted but does not detract from the legitimacy of the firm given the comprehensive and consistent website content. Strategic recommendations include publishing explicit security policies, establishing a vulnerability disclosure channel, and enhancing transparency around data protection officer contacts and certifications.

55
88
17
85
72
80
100
lawfirmlegalservicesenergyfinancialservicesrealestate+4 more
Google Tag ManagerOneTrust Cookie ConsentWebP imagesSVG graphics
2025-07-07T07:52:10.627Z
nglccny.org favicon

National LGBT Chamber of Commerce New York

nglccny.org

0
OtherUnited StatesmediumMEDIUM

The National LGBT Chamber of Commerce New York (nglccNY) serves as the New York Metro headquarters for the National LGBT Chamber of Commerce, a leading non-profit advocacy organization dedicated to expanding economic opportunities for the LGBT community. The organization focuses on certifying LGBT-owned businesses and advocating for their advancement in the marketplace. The website reflects a professional and consistent brand presence, targeting LGBT business owners and allies with services centered on certification and advocacy. Technically, the website is built on WordPress with modern frameworks such as Bootstrap and integrates SEO tools like Yoast SEO. It uses Google Analytics and Tag Manager for tracking and marketing forms for engagement. The site is hosted on Azure CDN, indicating a reliable hosting infrastructure. Mobile optimization and SEO practices are good, though accessibility features are basic. From a security perspective, the site uses HTTPS as indicated by canonical URLs, but lacks visible security headers in the provided data. No exposed sensitive data or vulnerabilities were detected. Privacy and cookie policies are not explicitly found, which is a compliance gap. WHOIS data is privacy protected or unavailable, which is typical for non-profits but limits domain trust verification. Overall, the website presents a trustworthy and professional front for a non-profit advocacy organization with moderate technical maturity and some room for improvement in privacy compliance and security hardening. Strategic recommendations include implementing explicit privacy and cookie policies, enhancing security headers, and improving accessibility to strengthen trust and compliance.

30
35
10
70
62
65
100
lgbtbusinessnon-profitcertificationadvocacy+2 more
WordPressYoast SEOGoogle AnalyticsFontAwesome+2
2025-07-07T06:44:07.316Z