Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 2092 of 2974|Showing 104551-104600 of 148685
diabetes.be favicon

Diabetes Liga

diabetes.be

0
HealthcareBelgiummediumMEDIUM

Diabetes Liga is a well-established non-profit organization based in Belgium focused on providing comprehensive information, support, and mobilization for people affected by diabetes. The website serves as a key resource for diabetes education, prevention programs, and community engagement, targeting patients, families, and healthcare professionals in the Flemish region. The organization maintains a strong market position as a trusted healthcare information provider with a professional digital presence. Technically, the website is built on Drupal 11, leveraging modern web technologies and Google Tag Manager for analytics and marketing. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital infrastructure. Security measures include HTTPS enforcement and standard security headers, though there is room for improvement in publishing explicit security policies and incident response details. The security posture is solid with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR requirements. However, the WHOIS data is restricted, which slightly impacts domain trustworthiness but is common for .be domains. Overall, the site presents a low-risk profile with strong business credibility and user trust. Strategic recommendations include enhancing transparency by publishing a security policy and incident response contacts, and considering a vulnerability disclosure policy to further strengthen security culture and stakeholder confidence.

40
83
2
75
72
70
20
healthcarediabetesnon-profiteducationmedical+2 more
Drupal 11Google Tag ManagerjQueryGoogle Fonts (Ubuntu)

Partner Domains:

shop.diabetes.be
partner
2025-07-07T05:35:17.491Z
indiegroup.be favicon

Indie Group

indiegroup.be

0
TechnologyBelgiummediumMEDIUM

Indie Group is a medium-sized digital agency based in Belgium specializing in digital strategy, development, and performance marketing. They leverage a team of over 50 experts to deliver tailored digital solutions focused on measurable business growth. The company holds strong partnerships with leading technology providers such as HubSpot, Google, TikTok, and Meta, positioning itself as a trusted HubSpot Gold Partner and technology integrator. Their service offerings include performance marketing, e-commerce development, analytics, and conversion optimization, targeting businesses seeking to enhance their digital presence and marketing effectiveness. Technically, the website is built on modern web technologies including Craft CMS, JavaScript frameworks, and integrates multiple tracking and marketing tools such as Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag. The site is well optimized for performance, mobile responsiveness, and SEO, reflecting a mature digital infrastructure. Security practices include HTTPS enforcement and use of reCAPTCHA v3 on forms, though there is room for improvement in publishing explicit security policies and headers. From a security perspective, the website demonstrates good baseline protections with encrypted connections and consent mechanisms for cookies, but lacks publicly available incident response or vulnerability disclosure information. The WHOIS data is restricted by the registry, which is common and justified for privacy reasons in this business context. Overall, the site presents a professional and trustworthy digital presence with no critical vulnerabilities detected. Strategically, Indie Group should consider enhancing transparency around security policies and incident response to further build trust with clients. Regular audits of third-party scripts and implementation of security headers would strengthen their security posture. Maintaining compliance with GDPR and evolving regulations will be essential as they continue to grow their digital marketing and technology services.

15
10
2
65
95
60
100
digitalagencyperformancemarketingtechnologysolutionshubspotpartnere-commerce+3 more
JavaScriptGoogle Tag ManagerFacebook PixelLinkedIn Insight Tag+5

Partner Domains:

hubspot.com
partner
google.com
partner

+3 more partners

2025-07-07T05:35:12.484Z
tvgg-ebooks.be favicon

Tijdschrift voor Geneeskunde en Gezondheidszorg

tvgg-ebooks.be

0
HealthcareBelgiumsmallMEDIUM

TvGG E-books is an e-commerce platform specializing in peer reviewed e-books targeted at healthcare professionals in the Flemish region of Belgium. It operates as an initiative of the Tijdschrift voor Geneeskunde en Gezondheidszorg, providing a curated selection of medical and healthcare publications. The platform offers immediate access to e-books without subscription fees, catering to doctors, nurses, pharmacists, and other care providers. The website demonstrates a professional and consistent brand presence with clear navigation and relevant content for its niche audience. Technically, the website is built on WordPress using WooCommerce for e-commerce functionality and Elementor for page building. It incorporates modern SEO practices via Yoast SEO and complies with GDPR through the Complianz cookie consent plugin. The site is mobile optimized and performs moderately well, though some accessibility features could be enhanced. No major performance or technical issues were detected. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers such as Content-Security-Policy or X-Frame-Options. The WHOIS data for the domain is restricted by the .be registry, limiting verification of domain ownership and age. However, the website content and business information appear legitimate and consistent with a professional healthcare publication platform. Overall, the site presents a low-risk profile with good privacy compliance and a clear business model. Strategic improvements in security headers, incident response transparency, and WHOIS data availability could further enhance trust and security posture.

15
85
2
60
75
60
100
healthcareebookspeerreviewedflanderswordpress+3 more
WordPressWooCommerceElementorYoast SEO+2

Partner Domains:

tvgg.be
partner
2025-07-07T05:34:27.381Z
F

Federal Reserve Bank of St. Louis

stlouisfed.org

0
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of St. Louis operates as one of the 12 regional Reserve Banks within the Federal Reserve System, serving a critical role in the U.S. central banking framework. The website provides extensive economic resources, data tools, research publications, and educational materials targeted at economists, financial institutions, educators, and the general public. It maintains a strong market position as an authoritative source for economic data and Federal Reserve information. Technically, the website employs a modern technology stack including Bootstrap 4, jQuery, Google Tag Manager, and analytics tools such as Google Analytics and Crazy Egg. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes several security best practices. While some security headers are not explicitly detected, the overall posture is strong with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance. Overall, the website is highly professional, trustworthy, and aligned with the Federal Reserve's mission. The lack of WHOIS data is mitigated by the authoritative content and branding. The site poses low risk and serves as a reliable resource for its audience.

-
58
25
70
-
85
100
federalreserveeconomicdatabankingresearcheducation+1 more
jQuery 3.7.1Bootstrap 4Google Tag ManagerGoogle Analytics+3

Partner Domains:

fred.stlouisfed.org
partner
fraser.stlouisfed.org
partner

+2 more partners

2025-07-07T05:34:17.366Z
C

Cities for Financial Empowerment Fund

cfefund.org

0
GovernmentUnited StatesmediumMEDIUM

Cities for Financial Empowerment Fund (CFE Fund) is a US-based non-profit organization founded in 2011 that supports mayors and local governments across the country by providing grant funding and strategic assistance to embed financial empowerment initiatives in municipal operations. The organization has a strong market position with partnerships in approximately 145 cities, directly supporting over 900,000 residents. Their key services include grant distribution, program development, and impact reporting focused on improving financial stability for city residents. Technically, the website is built on WordPress with a modern tech stack including Gravity Forms for data collection, Google Analytics for tracking, and Cloudflare for DNS management. The site demonstrates good mobile optimization, accessibility, and SEO practices, though performance is moderate. The infrastructure is typical for a mid-sized non-profit organization. From a security perspective, the site uses HTTPS and CAPTCHA on forms, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No exposed sensitive data or vulnerabilities were detected in the HTML content. Privacy compliance is basic, with a privacy policy and terms of service present but no cookie consent mechanism. Contact information is available, but no dedicated security policy or incident response contacts were found. Overall, the website is professional, trustworthy, and safe for general audiences. The security posture is adequate but could be improved with additional DNS and header configurations. The organization’s domain registration is privacy protected, consistent with non-profit practices, and the domain age aligns with the organization's history.

30
53
17
60
75
65
100
non-profitfinancialempowermentgovernmentcitiesgrants+1 more
WordPressGravity FormsGoogle AnalyticsCloudflare DNS+6
2025-07-07T05:34:12.358Z
biv.be favicon

Beroepsinstituut van Vastgoedmakelaars

biv.be

0
Real EstateBelgiummediumMEDIUM

The Beroepsinstituut van Vastgoedmakelaars (BIV) is the official professional institute and regulatory body for real estate brokers in Belgium. It focuses on ensuring integrity, professionalism, and compliance within the real estate sector by providing certification, training, complaint handling, and knowledge dissemination. The website serves as a comprehensive resource for brokers, trainees, and the public, offering detailed information on becoming a broker, ethical guidelines, and complaint procedures. The organization maintains a strong market position as the authoritative entity overseeing real estate professionals in Belgium. Technically, the website is built on Drupal 10, leveraging modern web technologies and integrating Google Tag Manager and Cookiebot for analytics and privacy compliance. The site is well-optimized for mobile devices, accessible, and SEO-friendly, with a professional design and clear navigation. Privacy and cookie policies are prominently available, demonstrating good compliance with GDPR requirements. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms. However, no advanced security headers or explicit security policies were detected, and no vulnerability disclosure or incident response contacts are published. The WHOIS data for the domain is restricted, limiting transparency about domain ownership, which slightly impacts trust but is common for .be domains. Overall, the website presents a professional, trustworthy, and well-maintained digital presence for the BIV, with minor recommendations to enhance security posture and transparency to further strengthen trust and compliance.

55
83
2
65
52
80
100
realestateregulatoryprofessionalinstitutebelgiumbiv+5 more
Drupal 10Google Tag ManagerCookiebotjQuery UI Autocomplete

Partner Domains:

ipi.be
partner
2025-07-07T05:33:52.322Z
lexology.com favicon

Law Business Research

lexology.com

0
MediaN/alargeMEDIUM

Lexology is a leading global platform delivering comprehensive international legal updates, analysis, and insights primarily targeted at law firms and in-house counsel. The platform offers a wide range of services including legal newsfeeds, research hubs, compliance calendars, masterclasses, and analytics tools, positioning itself as a key resource in the legal media sector. The website is professionally designed with consistent branding and good content quality, supporting its market position as a trusted legal intelligence provider. Technically, Lexology employs modern web technologies such as React, Google Analytics, Hotjar, and CookiePro for tracking and consent management, ensuring a mature digital infrastructure. Security posture is strong with HTTPS enforcement and standard security headers, although explicit security policies and incident response contacts are not publicly disclosed. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The absence of WHOIS data limits full verification of domain legitimacy, but the overall professional presentation and trust signals support a positive risk assessment. Strategic recommendations include publishing security policies, incident response contacts, and enhancing accessibility to further strengthen trust and compliance.

40
95
2
85
75
85
100
legalnewsmediacomplianceanalytics+3 more
ReactjQueryFontAwesomeGoogle Analytics+5
2025-07-07T05:33:47.313Z
paperstreet.com favicon

PaperStreet Web Design, Inc.

paperstreet.com

0
TechnologyUnited StatesmediumMEDIUM

PaperStreet Web Design, Inc. is a specialized digital marketing agency focused on law firm website design, SEO, PPC, content writing, branding, and internet marketing services. Established in 2001 and founded by a lawyer, the company has built a strong reputation with over 2,500 law firm clients worldwide. Their market position is reinforced by numerous industry awards and certifications, including Google Premier Partner status. The company targets law firms of all sizes and businesses seeking professional web design and marketing solutions. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, Swiper.js, and CallRail for analytics and call tracking. The site demonstrates excellent performance, mobile optimization, accessibility, and SEO best practices. The use of HTTPS and implied security headers indicates a strong security posture, although explicit security headers could be improved. Security-wise, the site shows good practices with no visible vulnerabilities or exposed sensitive data. However, there is no visible cookie consent mechanism, and no dedicated security or incident response pages were found. The WHOIS data is unavailable or privacy protected, which is common but reduces transparency. Overall, the site is professional, trustworthy, and secure with minor areas for improvement. The overall risk assessment is low, with recommendations to enhance privacy compliance by adding cookie consent, publishing security policies, and improving WHOIS transparency. The company’s strong business credibility and technical maturity position it well in the competitive law firm marketing space.

55
35
2
85
75
80
100
lawfirmwebdesigninternetmarketingseoppc+3 more
WordPressYoast SEO PremiumSwiper.jsCallRail+1

Partner Domains:

lawfirmessentials.com
partner
2025-07-07T05:33:42.305Z
L

Lewis Baach Kaufmann Middlemiss PLLC

lewisbaach.com

0
FinanceUnited StatessmallMEDIUM

Lewis Baach Kaufmann Middlemiss PLLC is a boutique international law firm specializing in complex litigation, financial crimes compliance, and international disputes with offices in Washington DC, New York, and London. The firm targets corporate clients, financial institutions, and professionals requiring expert legal services in areas such as bank fraud, asset tracing, and white collar criminal defense. Their market position is that of a specialized boutique firm with a strong reputation in financial and compliance legal matters. Technically, the website employs modern analytics and marketing tools including Google Analytics, Localize.js for language support, and Constant Contact for client engagement. The site is served over HTTPS with reCAPTCHA protecting forms, indicating a baseline security posture. However, the absence of security headers and cookie consent mechanisms suggests room for improvement in security and privacy compliance. Security-wise, the website shows no signs of vulnerabilities or exposed sensitive data. The lack of WHOIS data is a concern for domain legitimacy but does not detract significantly from the professional presentation and trust signals on the site. Overall, the site is secure but could enhance compliance and transparency. The overall risk is moderate with recommendations to improve security headers, implement cookie consent, publish incident response policies, and clarify domain registration details to strengthen trust and compliance.

40
53
17
80
62
80
100
lawlegallitigationcomplianceinternational+2 more
Google Analytics (gtag.js)Localize.jsConstant Contact signup formsGoogle reCAPTCHA
2025-07-07T05:33:32.286Z
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

0
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
hirschlerlaw.com favicon

Hirschler Fleischer

hirschlerlaw.com

0
Real EstateUnited StatesmediumMEDIUM

Hirschler Fleischer is a professional law firm based in Virginia, providing a broad range of legal services with a focus on client success and complex legal issues. The firm positions itself as a national-caliber entity with a strong emphasis on partner involvement and business efficiency. Their website reflects a medium-sized firm with consistent branding and professional content aimed at business and individual clients seeking legal counsel. Technically, the website employs modern web standards including HTTPS, Google Tag Manager for analytics, and responsive design elements. While the site performs moderately well and offers good accessibility and SEO features, there is room for improvement in security headers and cookie consent mechanisms to enhance privacy compliance. From a security perspective, the site benefits from HTTPS and secure form practices but lacks visible security headers and a formal vulnerability disclosure policy. The absence of WHOIS data raises questions about domain registration legitimacy, although the professional presentation and external references support the firm's credibility. Overall, the site is safe, trustworthy, and suitable for general audiences. Strategically, the firm should address privacy compliance gaps, enhance security headers, and clarify domain registration details to strengthen trust and security posture.

40
53
17
70
72
80
100
lawfirmlegalservicesvirginiaprofessionalservicesbusinesslaw+1 more
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:33:17.250Z
wiley.law favicon

Wiley Rein LLP

wiley.law

0
GovernmentUnited StateslargeMEDIUM

Wiley Rein LLP is a prominent law firm based in Washington, DC, specializing in a broad range of legal fields including Election Law, Environment, Government Contracts, Insurance, Intellectual Property, International Trade, Litigation, Telecom, and White Collar Defense. The firm boasts a large team of 260 attorneys and maintains a strong market position as a leading legal service provider with deep government connections. Their business model focuses on delivering specialized legal and regulatory advice to corporate and government clients. The website reflects a professional and authoritative presence consistent with their market stature. Technically, the website employs modern analytics and tracking technologies such as Google Analytics, Google Tag Manager, Hotjar, and Siteimprove Analytics, combined with a responsive design and good accessibility features. The site is well-structured with clear navigation and optimized for SEO, providing a positive user experience. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms aligned with GDPR compliance. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data is unavailable, likely due to privacy protection, which is justified for a law firm. Overall, the security posture is solid but could be enhanced with additional headers and transparency. The overall risk assessment is low, with the website demonstrating high professionalism, trustworthiness, and compliance. Strategic recommendations include implementing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen security and trust.

70
68
17
80
52
80
100
lawfirmlegalserviceswashingtondcgovernmentcontractsintellectualproperty+4 more
Google Tag ManagerGoogle AnalyticsHotjarSiteimprove Analytics+1
2025-07-07T05:33:07.224Z
L

Law.com, Inc.

law.com

0
MediaUnited StateslargeMEDIUM

Law.com, Inc. operates as a premier global legal news and information provider, delivering trusted and timely legal news, analysis, and data to legal professionals. Positioned as a leading media entity in the legal sector, it offers a subscription-based business model targeting legal professionals and organizations. The company is a subsidiary of ALM, a well-established media group, and has been in operation since 1998. The website reflects a professional and authoritative brand with excellent content quality and strong trust indicators such as industry awards and verified contact information. Technically, the website leverages modern web technologies including Nuxt.js and Vue.js frameworks, supported by AWS Cloudfront CDN for performance optimization. The site is mobile-optimized, accessible, and SEO-friendly, with a fast loading experience. Integration with marketing and analytics tools such as Omeda and Tealium indicates a mature digital infrastructure. From a security perspective, the site enforces HTTPS and employs best practices such as asynchronous script loading and no visible vulnerable libraries. However, explicit security headers and a cookie consent mechanism are not clearly detected, suggesting areas for improvement. The absence of WHOIS data is noted but likely due to privacy or registry restrictions, not detracting significantly from the site's legitimacy given its strong brand presence. Overall, Law.com presents a low-risk profile with a strong business and technical foundation. Strategic recommendations include enhancing privacy compliance with visible cookie consent, improving security headers, and publishing a vulnerability disclosure policy to further strengthen trust and security posture.

15
58
47
70
75
80
100
legalnewsmedialawlegalresources+2 more
JavaScriptTailwindCSSVue.js (implied by Nuxt.js usage)Nuxt.js+3

Partner Domains:

alm.com
parent
verdictsearch.com
partner

+1 more partners

2025-07-07T05:33:02.215Z
sheppardmullin.com favicon

Sheppard Mullin

sheppardmullin.com

0
OtherUnited StateslargeMEDIUM

Sheppard Mullin is a prominent AmLaw 100 law firm with a broad international presence across the United States, Europe, and Asia. The firm offers a comprehensive range of legal services spanning numerous practice areas including corporate law, litigation, intellectual property, privacy and cybersecurity, and more. Their website reflects a mature digital presence with professional branding, clear navigation, and extensive content tailored to corporate clients and legal professionals. The firm positions itself as a leader in the legal industry with recognized awards and a strong market reputation. From a technical perspective, the website employs modern web technologies including Google Tag Manager, Adobe DTM, and various analytics and marketing pixels. The site is mobile-optimized and includes accessibility features such as the UserWay widget, indicating a commitment to compliance and user inclusivity. Performance is moderate with good SEO and accessibility standards met. Security-wise, the site enforces HTTPS and uses several best practices, though it lacks explicit security headers and a public security policy or vulnerability disclosure page. No critical vulnerabilities or exposed sensitive data were detected. Privacy compliance is strong with clear privacy and cookie policies and consent mechanisms in place. Overall, the website presents a low risk profile with a high degree of professionalism and trustworthiness. The absence of WHOIS data is a notable anomaly but does not detract significantly from the site's legitimacy given the comprehensive and consistent business information presented. Strategic recommendations include enhancing security headers, publishing a security policy, and adding a vulnerability disclosure mechanism to further strengthen trust and security posture.

70
68
47
70
67
85
100
lawfirmlegalservicesamlaw100privacypolicycookiepolicy+2 more
JavaScriptGoogle Tag ManagerSiteimprove AnalyticsLinkedIn Insight Tag+3
2025-07-07T05:32:42.180Z
schwabe.com favicon

Schwabe

schwabe.com

0
OtherUnited StateslargeMEDIUM

Schwabe is a well-established regional law firm with over 130 years of history, focusing on providing tailored legal services across various industries in the Northwest United States. Their website reflects a professional and comprehensive presentation of their services, emphasizing industry-specific expertise and client commitment. The firm targets businesses and legal professionals seeking specialized counsel in sectors such as manufacturing, healthcare, natural resources, maritime, real estate, and technology. The business model centers on delivering legal solutions aligned with regional and industry needs, positioning Schwabe as a trusted legal partner in their market. Technically, the website is built on WordPress and incorporates modern web technologies including Google Fonts, Google Tag Manager, and New Relic for performance monitoring. The site is mobile-optimized, accessible, and SEO-friendly, with a fast to moderate performance profile. Security measures include HTTPS enforcement, use of Google reCAPTCHA on forms, and a cookie consent mechanism, indicating a mature digital infrastructure. From a security perspective, the site demonstrates good practices such as encrypted connections and bot protection. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. The absence of WHOIS data reduces transparency but does not detract significantly from the site's legitimacy given the professional presentation and consistent branding. Overall, Schwabe's website presents a low-risk profile with strong business credibility and a solid technical foundation. Strategic recommendations include enhancing security headers, publishing security policies, and improving WHOIS transparency to further strengthen trust and compliance.

25
53
2
70
95
80
100
lawfirmlegalservicesprofessionalservicesregionalbusinessindustryfocused
WordPressGoogle FontsGoogle Tag ManagerGoogle reCAPTCHA+2
2025-07-07T05:32:32.166Z
M

Mitchell Silberberg & Knupp LLP

msk.com

0
MediaUnited StateslargeMEDIUM

Mitchell Silberberg & Knupp LLP is a well-established full-service law firm with deep roots in the Los Angeles entertainment industry since 1908. The firm has expanded nationally with offices in Los Angeles, New York, and Washington, D.C., offering a broad range of legal services including intellectual property, litigation, labor and employment, corporate law, immigration, regulatory, tax, and trusts & estates. The website reflects a professional and stable firm culture with a focus on creative legal advisory and business partnership. Technically, the website employs modern web technologies such as HTML5 video, JWPlayer, and integrates Google Analytics and Tag Manager for tracking. The site is moderately optimized for performance and mobile use, with good SEO practices evident in meta tags and structured content. Security posture is adequate with HTTPS implied, but lacks visible security headers and explicit privacy or cookie policies, which are areas for improvement. The absence of WHOIS data raises some concerns about domain registration transparency, though the website content and branding strongly support legitimacy. Overall, the site is professional and trustworthy but would benefit from enhanced privacy compliance and security best practices.

40
35
17
60
42
75
100
lawfirmlegalservicesentertainmentindustryintellectualpropertylitigation+3 more
jwplayer 7.0.0Google Tag ManagerGoogle AnalyticsHTML5 video+2
2025-07-07T05:32:27.159Z
wwhgd.com favicon

Weinberg Wheeler

wwhgd.com

0
OtherUnited StatesmediumMEDIUM

Weinberg, Wheeler, Hudgins, Gunn & Dial, LLC is a national litigation law firm specializing in complex, high-exposure cases, particularly in construction law and catastrophic legal disputes. The firm positions itself as a bold and innovative advocate with extensive trial and arbitration experience across multiple states. Their website reflects a professional and polished digital presence, targeting corporate clients, insurance carriers, and legal professionals seeking expert litigation services. The firm emphasizes its strategic approach and proven track record through client testimonials and detailed service descriptions. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, WebP images for optimized media delivery, and HTML5 video content. The site is mobile-optimized with good accessibility and SEO practices. However, no CMS or hosting provider details are explicitly identified. Performance is moderate with room for improvement in security header implementation. From a security perspective, the site uses HTTPS and has a cookie consent mechanism aligned with privacy regulations, including GDPR compliance. However, no explicit security policies or incident response contacts are published, and security headers are not detected, which could be improved to enhance protection and trust. The absence of WHOIS data for the domain is a notable concern, as it reduces transparency and trustworthiness from a domain registration standpoint. Overall, the website is professional and trustworthy in content and design but would benefit from improved domain registration transparency and enhanced security practices to strengthen its risk posture and compliance stance.

55
68
17
70
72
80
100
lawfirmlitigationconstructionlawtrialadvocacylegalservices+3 more
Google AnalyticsGoogle Tag ManagerSlick CarouselCustom JavaScript+2
2025-07-07T05:32:22.151Z
irell.com favicon

Irell & Manella LLP

irell.com

0
OtherUnited StatesmediumMEDIUM

Irell & Manella LLP is a reputable law firm specializing in high-stakes business litigation, including patent litigation, securities fraud defense, and complex contract disputes. The firm is recognized for achieving exceptional client outcomes and holds ISO 27001 certification, underscoring its commitment to information security. The website presents a professional and well-structured digital presence targeting corporate clients and legal professionals. Technically, the website employs modern web technologies including Google Tag Manager for analytics and tracking, with good mobile optimization and accessibility features. The site uses HTTPS with an excellent SSL configuration, though security headers are not explicitly detected. Privacy compliance is strong with a comprehensive privacy policy and cookie consent mechanism. Security posture is solid, supported by ISO 27001 certification and secure website practices, but could be improved by adding visible security headers and publishing incident response or vulnerability disclosure information. The absence of WHOIS data is unusual but does not detract significantly from the site's legitimacy given the professional content and trust signals. Overall, the website is trustworthy, professional, and secure with minor areas for improvement in security transparency and contact information visibility.

40
53
17
65
72
80
100
lawfirmbusinesslitigationpatentlitigationiso27001legalservices
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:32:17.143Z
aalrr.com favicon

Atkinson, Andelson, Loya, Ruud & Romo

aalrr.com

0
OtherUnited StateslargeMEDIUM

Atkinson, Andelson, Loya, Ruud & Romo is a well-established California-based law firm with over 40 years of experience and a large team of over 200 attorneys across nine offices. The firm offers a broad range of legal services including labor and employment law, corporate finance, education law, litigation, and public safety, targeting both public and private sector clients. Their market position is strong within California, supported by awards, client testimonials, and recognized diversity initiatives. Technically, the website employs modern web technologies such as jwplayer for media, Google Analytics and Tag Manager for tracking, and HubSpot for marketing and analytics. The site is well-structured, mobile-optimized, and accessible, with good SEO practices and a comprehensive cookie consent mechanism. However, no CMS or hosting provider details were explicitly identified. From a security perspective, the site enforces HTTPS and provides cookie consent management, but lacks explicit security headers and a published security policy or incident response contacts. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS domain registration data is a notable concern, potentially indicating privacy protection or a registration anomaly, which slightly impacts trustworthiness. Overall, the website is professional, trustworthy, and compliant with privacy regulations, but would benefit from enhanced transparency in domain registration and explicit security policies to improve its security posture and business credibility.

40
83
17
80
62
80
100
legallawfirmcaliforniaattorneysprivacy+4 more
jwplayerGoogle AnalyticsGoogle Tag ManagerHubSpot+2
2025-07-07T05:32:12.136Z
calfee.com favicon

Calfee, Halter & Griswold LLP

calfee.com

0
OtherUnited StateslargeMEDIUM

Calfee, Halter & Griswold LLP is a well-established full-service corporate law firm with over 120 years of experience, serving clients primarily in the Midwest United States but also nationally and globally through its partnership with Lex Mundi. The firm offers a broad range of legal services including corporate and finance, litigation, intellectual property, government relations, and various business support practices. The website reflects a mature and professional organization with strong market positioning and client trust evidenced by industry rankings and testimonials. Technically, the website employs modern web technologies such as jwplayer for media, Google Tag Manager, and LinkedIn Insight for analytics and marketing. The site is well-structured, mobile-optimized, and demonstrates good SEO and accessibility practices. Privacy and cookie policies are clearly presented with consent mechanisms, indicating compliance with GDPR and other privacy regulations. From a security perspective, the site uses HTTPS and secure forms, but lacks explicit security headers and a published security.txt file. No critical vulnerabilities or exposed sensitive data were detected. The WHOIS data is not publicly available, which slightly reduces transparency but is not uncommon for professional services firms. Overall, the website presents a low-risk profile with strong business credibility and good security hygiene. Strategic improvements in security header implementation and incident response transparency would further enhance trust and resilience.

40
68
47
85
72
85
100
lawfirmcorporatelawintellectualpropertylitigationgovernmentrelations+4 more
jwplayerGoogle Tag ManagerLinkedIn Insight TagTypekit Fonts

Partner Domains:

connect.calfee.com
service
www.linkedin.com
partner

+3 more partners

2025-07-07T05:32:07.128Z
stinson.com favicon

Stinson LLP

stinson.com

0
OtherUnited StateslargeMEDIUM

Stinson LLP is a well-established law firm providing a broad range of legal services to individuals, privately held enterprises, national companies, and international public corporations. The firm emphasizes practical legal guidance, risk minimization, and opportunity realization, supported by a collaborative culture and extensive legal knowledge. Their market position is strong, with multiple office locations across the United States and recognition in legal rankings such as Chambers USA. The website reflects a professional and trustworthy brand with clear navigation and comprehensive content. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, uses web fonts for branding consistency, and implements HTTPS with good security practices. The site is mobile optimized and accessible, with cookie consent mechanisms in place indicating GDPR compliance awareness. However, some advanced security headers are missing, and no explicit security policy or incident response contact information is published. From a security perspective, the site demonstrates a solid posture with HTTPS enforced and secure form handling. No vulnerabilities or exposed sensitive data were detected. The absence of WHOIS data is notable but does not detract significantly from the site's legitimacy given the professional content and external trust signals. Overall, the site scores well on content quality, technical implementation, security, privacy compliance, and business credibility, making it a reliable and professional online presence for Stinson LLP.

55
68
17
65
72
85
100
lawfirmlegalservicesattorneysprofessionalservicesprivacypolicy+2 more
Google AnalyticsGoogle Tag ManagerWeb fonts (Brandon Grotesque, Freight Text Pro)JavaScript+2

Partner Domains:

paytrace.com
partner
firmseek.com
partner
2025-07-07T05:32:02.121Z