Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 2093 of 2975|Showing 104601-104650 of 148741
glaifa-lichtreclame.com favicon

Glaifa Lichtreclame

glaifa-lichtreclame.com

0
RetailNetherlandsmediumHIGH

Glaifa Lichtreclame is a well-established Dutch company specializing in the production and installation of light advertising, facade signage, and related products for businesses. With over 75 years of experience and recognized certifications such as installQ and membership in Techniek Nederland, Glaifa positions itself as a trusted partner for companies seeking high-quality signage solutions. Their website reflects a professional and comprehensive digital presence, offering detailed service descriptions, project showcases, and multiple contact channels including forms protected by Google reCAPTCHA. Technically, the website employs modern web technologies including Mapbox for mapping, Google Tag Manager, Google Analytics, Microsoft Clarity, Hotjar, and ClickCease for analytics and security. The site is mobile-optimized with good SEO practices and a clean, consistent design. Security measures include HTTPS enforcement and spam protection on forms, though explicit security headers are not detected, indicating room for improvement. From a security and compliance perspective, the site maintains privacy and cookie policies with consent mechanisms, aligning with GDPR requirements. However, the lack of WHOIS data for the domain raises questions about domain registration transparency, though the professional nature of the site and presence of valid contact information mitigate immediate concerns. No critical vulnerabilities or adult content are present, and the site is safe for general audiences. Overall, Glaifa Lichtreclame demonstrates a strong business and technical foundation with minor areas for security enhancement and domain registration verification. Strategic recommendations include implementing security headers, clarifying domain registration status, and maintaining rigorous third-party script audits to ensure ongoing security and compliance.

20
68
2
60
72
70
20
lichtreclamegevelreclamegevellettersreclamezuilenlichtbakken+4 more
Mapbox GL JSGoogle Tag ManagerGoogle AnalyticsMicrosoft Clarity+4

Partner Domains:

publima.be
partner
2025-07-07T05:36:42.910Z
diabetes.be favicon

Diabetes Liga

diabetes.be

0
HealthcareBelgiummediumMEDIUM

Diabetes Liga is a well-established non-profit organization based in Belgium focused on providing comprehensive information, support, and mobilization for people affected by diabetes. The website serves as a key resource for diabetes education, prevention programs, and community engagement, targeting patients, families, and healthcare professionals in the Flemish region. The organization maintains a strong market position as a trusted healthcare information provider with a professional digital presence. Technically, the website is built on Drupal 11, leveraging modern web technologies and Google Tag Manager for analytics and marketing. The site is mobile-optimized, accessible, and SEO-friendly, reflecting a mature digital infrastructure. Security measures include HTTPS enforcement and standard security headers, though there is room for improvement in publishing explicit security policies and incident response details. The security posture is solid with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms, aligning with GDPR requirements. However, the WHOIS data is restricted, which slightly impacts domain trustworthiness but is common for .be domains. Overall, the site presents a low-risk profile with strong business credibility and user trust. Strategic recommendations include enhancing transparency by publishing a security policy and incident response contacts, and considering a vulnerability disclosure policy to further strengthen security culture and stakeholder confidence.

40
83
2
75
72
70
20
healthcarediabetesnon-profiteducationmedical+2 more
Drupal 11Google Tag ManagerjQueryGoogle Fonts (Ubuntu)

Partner Domains:

shop.diabetes.be
partner
2025-07-07T05:35:17.491Z
indiegroup.be favicon

Indie Group

indiegroup.be

0
TechnologyBelgiummediumMEDIUM

Indie Group is a medium-sized digital agency based in Belgium specializing in digital strategy, development, and performance marketing. They leverage a team of over 50 experts to deliver tailored digital solutions focused on measurable business growth. The company holds strong partnerships with leading technology providers such as HubSpot, Google, TikTok, and Meta, positioning itself as a trusted HubSpot Gold Partner and technology integrator. Their service offerings include performance marketing, e-commerce development, analytics, and conversion optimization, targeting businesses seeking to enhance their digital presence and marketing effectiveness. Technically, the website is built on modern web technologies including Craft CMS, JavaScript frameworks, and integrates multiple tracking and marketing tools such as Google Tag Manager, Facebook Pixel, and LinkedIn Insight Tag. The site is well optimized for performance, mobile responsiveness, and SEO, reflecting a mature digital infrastructure. Security practices include HTTPS enforcement and use of reCAPTCHA v3 on forms, though there is room for improvement in publishing explicit security policies and headers. From a security perspective, the website demonstrates good baseline protections with encrypted connections and consent mechanisms for cookies, but lacks publicly available incident response or vulnerability disclosure information. The WHOIS data is restricted by the registry, which is common and justified for privacy reasons in this business context. Overall, the site presents a professional and trustworthy digital presence with no critical vulnerabilities detected. Strategically, Indie Group should consider enhancing transparency around security policies and incident response to further build trust with clients. Regular audits of third-party scripts and implementation of security headers would strengthen their security posture. Maintaining compliance with GDPR and evolving regulations will be essential as they continue to grow their digital marketing and technology services.

15
10
2
65
95
60
100
digitalagencyperformancemarketingtechnologysolutionshubspotpartnere-commerce+3 more
JavaScriptGoogle Tag ManagerFacebook PixelLinkedIn Insight Tag+5

Partner Domains:

hubspot.com
partner
google.com
partner

+3 more partners

2025-07-07T05:35:12.484Z
tvgg-ebooks.be favicon

Tijdschrift voor Geneeskunde en Gezondheidszorg

tvgg-ebooks.be

0
HealthcareBelgiumsmallMEDIUM

TvGG E-books is an e-commerce platform specializing in peer reviewed e-books targeted at healthcare professionals in the Flemish region of Belgium. It operates as an initiative of the Tijdschrift voor Geneeskunde en Gezondheidszorg, providing a curated selection of medical and healthcare publications. The platform offers immediate access to e-books without subscription fees, catering to doctors, nurses, pharmacists, and other care providers. The website demonstrates a professional and consistent brand presence with clear navigation and relevant content for its niche audience. Technically, the website is built on WordPress using WooCommerce for e-commerce functionality and Elementor for page building. It incorporates modern SEO practices via Yoast SEO and complies with GDPR through the Complianz cookie consent plugin. The site is mobile optimized and performs moderately well, though some accessibility features could be enhanced. No major performance or technical issues were detected. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers such as Content-Security-Policy or X-Frame-Options. The WHOIS data for the domain is restricted by the .be registry, limiting verification of domain ownership and age. However, the website content and business information appear legitimate and consistent with a professional healthcare publication platform. Overall, the site presents a low-risk profile with good privacy compliance and a clear business model. Strategic improvements in security headers, incident response transparency, and WHOIS data availability could further enhance trust and security posture.

15
85
2
60
75
60
100
healthcareebookspeerreviewedflanderswordpress+3 more
WordPressWooCommerceElementorYoast SEO+2

Partner Domains:

tvgg.be
partner
2025-07-07T05:34:27.381Z
F

Federal Reserve Bank of St. Louis

stlouisfed.org

0
GovernmentUnited StateslargeMEDIUM

The Federal Reserve Bank of St. Louis operates as one of the 12 regional Reserve Banks within the Federal Reserve System, serving a critical role in the U.S. central banking framework. The website provides extensive economic resources, data tools, research publications, and educational materials targeted at economists, financial institutions, educators, and the general public. It maintains a strong market position as an authoritative source for economic data and Federal Reserve information. Technically, the website employs a modern technology stack including Bootstrap 4, jQuery, Google Tag Manager, and analytics tools such as Google Analytics and Crazy Egg. The site is mobile-optimized, accessible, and demonstrates good SEO practices. Performance is moderate with room for optimization. From a security perspective, the site enforces HTTPS with strong SSL configuration and includes several security best practices. While some security headers are not explicitly detected, the overall posture is strong with no evident vulnerabilities or exposed sensitive data. Privacy compliance is well addressed with clear privacy and cookie policies, including consent mechanisms and GDPR compliance. Overall, the website is highly professional, trustworthy, and aligned with the Federal Reserve's mission. The lack of WHOIS data is mitigated by the authoritative content and branding. The site poses low risk and serves as a reliable resource for its audience.

-
58
25
70
-
85
100
federalreserveeconomicdatabankingresearcheducation+1 more
jQuery 3.7.1Bootstrap 4Google Tag ManagerGoogle Analytics+3

Partner Domains:

fred.stlouisfed.org
partner
fraser.stlouisfed.org
partner

+2 more partners

2025-07-07T05:34:17.366Z
C

Cities for Financial Empowerment Fund

cfefund.org

0
GovernmentUnited StatesmediumMEDIUM

Cities for Financial Empowerment Fund (CFE Fund) is a US-based non-profit organization founded in 2011 that supports mayors and local governments across the country by providing grant funding and strategic assistance to embed financial empowerment initiatives in municipal operations. The organization has a strong market position with partnerships in approximately 145 cities, directly supporting over 900,000 residents. Their key services include grant distribution, program development, and impact reporting focused on improving financial stability for city residents. Technically, the website is built on WordPress with a modern tech stack including Gravity Forms for data collection, Google Analytics for tracking, and Cloudflare for DNS management. The site demonstrates good mobile optimization, accessibility, and SEO practices, though performance is moderate. The infrastructure is typical for a mid-sized non-profit organization. From a security perspective, the site uses HTTPS and CAPTCHA on forms, but lacks DNSSEC and explicit security headers, which are recommended for enhanced protection. No exposed sensitive data or vulnerabilities were detected in the HTML content. Privacy compliance is basic, with a privacy policy and terms of service present but no cookie consent mechanism. Contact information is available, but no dedicated security policy or incident response contacts were found. Overall, the website is professional, trustworthy, and safe for general audiences. The security posture is adequate but could be improved with additional DNS and header configurations. The organization’s domain registration is privacy protected, consistent with non-profit practices, and the domain age aligns with the organization's history.

30
53
17
60
75
65
100
non-profitfinancialempowermentgovernmentcitiesgrants+1 more
WordPressGravity FormsGoogle AnalyticsCloudflare DNS+6
2025-07-07T05:34:12.358Z
biv.be favicon

Beroepsinstituut van Vastgoedmakelaars

biv.be

0
Real EstateBelgiummediumMEDIUM

The Beroepsinstituut van Vastgoedmakelaars (BIV) is the official professional institute and regulatory body for real estate brokers in Belgium. It focuses on ensuring integrity, professionalism, and compliance within the real estate sector by providing certification, training, complaint handling, and knowledge dissemination. The website serves as a comprehensive resource for brokers, trainees, and the public, offering detailed information on becoming a broker, ethical guidelines, and complaint procedures. The organization maintains a strong market position as the authoritative entity overseeing real estate professionals in Belgium. Technically, the website is built on Drupal 10, leveraging modern web technologies and integrating Google Tag Manager and Cookiebot for analytics and privacy compliance. The site is well-optimized for mobile devices, accessible, and SEO-friendly, with a professional design and clear navigation. Privacy and cookie policies are prominently available, demonstrating good compliance with GDPR requirements. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms. However, no advanced security headers or explicit security policies were detected, and no vulnerability disclosure or incident response contacts are published. The WHOIS data for the domain is restricted, limiting transparency about domain ownership, which slightly impacts trust but is common for .be domains. Overall, the website presents a professional, trustworthy, and well-maintained digital presence for the BIV, with minor recommendations to enhance security posture and transparency to further strengthen trust and compliance.

55
83
2
65
52
80
100
realestateregulatoryprofessionalinstitutebelgiumbiv+5 more
Drupal 10Google Tag ManagerCookiebotjQuery UI Autocomplete

Partner Domains:

ipi.be
partner
2025-07-07T05:33:52.322Z
lexology.com favicon

Law Business Research

lexology.com

0
MediaN/alargeMEDIUM

Lexology is a leading global platform delivering comprehensive international legal updates, analysis, and insights primarily targeted at law firms and in-house counsel. The platform offers a wide range of services including legal newsfeeds, research hubs, compliance calendars, masterclasses, and analytics tools, positioning itself as a key resource in the legal media sector. The website is professionally designed with consistent branding and good content quality, supporting its market position as a trusted legal intelligence provider. Technically, Lexology employs modern web technologies such as React, Google Analytics, Hotjar, and CookiePro for tracking and consent management, ensuring a mature digital infrastructure. Security posture is strong with HTTPS enforcement and standard security headers, although explicit security policies and incident response contacts are not publicly disclosed. Privacy compliance is well addressed with clear privacy and cookie policies and consent mechanisms. The absence of WHOIS data limits full verification of domain legitimacy, but the overall professional presentation and trust signals support a positive risk assessment. Strategic recommendations include publishing security policies, incident response contacts, and enhancing accessibility to further strengthen trust and compliance.

40
95
2
85
75
85
100
legalnewsmediacomplianceanalytics+3 more
ReactjQueryFontAwesomeGoogle Analytics+5
2025-07-07T05:33:47.313Z
paperstreet.com favicon

PaperStreet Web Design, Inc.

paperstreet.com

0
TechnologyUnited StatesmediumMEDIUM

PaperStreet Web Design, Inc. is a specialized digital marketing agency focused on law firm website design, SEO, PPC, content writing, branding, and internet marketing services. Established in 2001 and founded by a lawyer, the company has built a strong reputation with over 2,500 law firm clients worldwide. Their market position is reinforced by numerous industry awards and certifications, including Google Premier Partner status. The company targets law firms of all sizes and businesses seeking professional web design and marketing solutions. Technically, the website is built on WordPress with a modern tech stack including Yoast SEO, Swiper.js, and CallRail for analytics and call tracking. The site demonstrates excellent performance, mobile optimization, accessibility, and SEO best practices. The use of HTTPS and implied security headers indicates a strong security posture, although explicit security headers could be improved. Security-wise, the site shows good practices with no visible vulnerabilities or exposed sensitive data. However, there is no visible cookie consent mechanism, and no dedicated security or incident response pages were found. The WHOIS data is unavailable or privacy protected, which is common but reduces transparency. Overall, the site is professional, trustworthy, and secure with minor areas for improvement. The overall risk assessment is low, with recommendations to enhance privacy compliance by adding cookie consent, publishing security policies, and improving WHOIS transparency. The company’s strong business credibility and technical maturity position it well in the competitive law firm marketing space.

55
35
2
85
75
80
100
lawfirmwebdesigninternetmarketingseoppc+3 more
WordPressYoast SEO PremiumSwiper.jsCallRail+1

Partner Domains:

lawfirmessentials.com
partner
2025-07-07T05:33:42.305Z
L

Lewis Baach Kaufmann Middlemiss PLLC

lewisbaach.com

0
FinanceUnited StatessmallMEDIUM

Lewis Baach Kaufmann Middlemiss PLLC is a boutique international law firm specializing in complex litigation, financial crimes compliance, and international disputes with offices in Washington DC, New York, and London. The firm targets corporate clients, financial institutions, and professionals requiring expert legal services in areas such as bank fraud, asset tracing, and white collar criminal defense. Their market position is that of a specialized boutique firm with a strong reputation in financial and compliance legal matters. Technically, the website employs modern analytics and marketing tools including Google Analytics, Localize.js for language support, and Constant Contact for client engagement. The site is served over HTTPS with reCAPTCHA protecting forms, indicating a baseline security posture. However, the absence of security headers and cookie consent mechanisms suggests room for improvement in security and privacy compliance. Security-wise, the website shows no signs of vulnerabilities or exposed sensitive data. The lack of WHOIS data is a concern for domain legitimacy but does not detract significantly from the professional presentation and trust signals on the site. Overall, the site is secure but could enhance compliance and transparency. The overall risk is moderate with recommendations to improve security headers, implement cookie consent, publish incident response policies, and clarify domain registration details to strengthen trust and compliance.

40
53
17
80
62
80
100
lawlegallitigationcomplianceinternational+2 more
Google Analytics (gtag.js)Localize.jsConstant Contact signup formsGoogle reCAPTCHA
2025-07-07T05:33:32.286Z
bartlit-beck.com favicon

Bartlit Beck LLP

bartlit-beck.com

0
OtherUnited StatesmediumMEDIUM

Bartlit Beck LLP is a nationally recognized boutique law firm specializing in trial practice and corporate transactions. The firm targets corporate clients and individuals requiring high-stakes litigation and corporate legal services. Their business model emphasizes success-based fee arrangements and delivering exceptional client outcomes, supported by numerous industry awards and client testimonials. The website reflects a professional and consistent brand image with comprehensive content tailored to their target audience. Technically, the website employs modern web technologies including Google Analytics and Tag Manager for tracking, with custom CSS and JavaScript for user experience enhancements. The site is mobile optimized, accessible, and SEO-friendly, though no CMS or hosting provider details are explicitly identified. Performance is moderate, with good navigation and content structure. From a security perspective, the site enforces HTTPS and implements cookie consent mechanisms, but lacks visible security headers and formal security or incident response policies. No vulnerabilities or exposed sensitive data were detected. The WHOIS data is notably missing or inaccessible, which raises some concerns about domain registration transparency, though the website content and professional presentation strongly indicate legitimacy. Overall, the site scores well on content quality, business credibility, and technical implementation, with room for improvement in security policy transparency and WHOIS data availability.

40
53
2
65
62
70
100
lawfirmlegalservicestrialpracticecorporatetransactionsprofessionalservices
Google AnalyticsGoogle Tag ManagerjQuery (implied by cycle plugin usage)Custom CSS and JS
2025-07-07T05:33:22.269Z
hirschlerlaw.com favicon

Hirschler Fleischer

hirschlerlaw.com

0
Real EstateUnited StatesmediumMEDIUM

Hirschler Fleischer is a professional law firm based in Virginia, providing a broad range of legal services with a focus on client success and complex legal issues. The firm positions itself as a national-caliber entity with a strong emphasis on partner involvement and business efficiency. Their website reflects a medium-sized firm with consistent branding and professional content aimed at business and individual clients seeking legal counsel. Technically, the website employs modern web standards including HTTPS, Google Tag Manager for analytics, and responsive design elements. While the site performs moderately well and offers good accessibility and SEO features, there is room for improvement in security headers and cookie consent mechanisms to enhance privacy compliance. From a security perspective, the site benefits from HTTPS and secure form practices but lacks visible security headers and a formal vulnerability disclosure policy. The absence of WHOIS data raises questions about domain registration legitimacy, although the professional presentation and external references support the firm's credibility. Overall, the site is safe, trustworthy, and suitable for general audiences. Strategically, the firm should address privacy compliance gaps, enhance security headers, and clarify domain registration details to strengthen trust and security posture.

40
53
17
70
72
80
100
lawfirmlegalservicesvirginiaprofessionalservicesbusinesslaw+1 more
Google Tag ManagerJavaScriptCSSHTML5
2025-07-07T05:33:17.250Z
wiley.law favicon

Wiley Rein LLP

wiley.law

0
GovernmentUnited StateslargeMEDIUM

Wiley Rein LLP is a prominent law firm based in Washington, DC, specializing in a broad range of legal fields including Election Law, Environment, Government Contracts, Insurance, Intellectual Property, International Trade, Litigation, Telecom, and White Collar Defense. The firm boasts a large team of 260 attorneys and maintains a strong market position as a leading legal service provider with deep government connections. Their business model focuses on delivering specialized legal and regulatory advice to corporate and government clients. The website reflects a professional and authoritative presence consistent with their market stature. Technically, the website employs modern analytics and tracking technologies such as Google Analytics, Google Tag Manager, Hotjar, and Siteimprove Analytics, combined with a responsive design and good accessibility features. The site is well-structured with clear navigation and optimized for SEO, providing a positive user experience. Performance is moderate, with room for optimization. From a security perspective, the site enforces HTTPS and includes cookie consent mechanisms aligned with GDPR compliance. However, explicit security headers are not detected, and there is no publicly available security policy or incident response information. No vulnerabilities or exposed sensitive data were found in the HTML content. The WHOIS data is unavailable, likely due to privacy protection, which is justified for a law firm. Overall, the security posture is solid but could be enhanced with additional headers and transparency. The overall risk assessment is low, with the website demonstrating high professionalism, trustworthiness, and compliance. Strategic recommendations include implementing security headers, publishing a security policy, and establishing a vulnerability disclosure process to further strengthen security and trust.

70
68
17
80
52
80
100
lawfirmlegalserviceswashingtondcgovernmentcontractsintellectualproperty+4 more
Google Tag ManagerGoogle AnalyticsHotjarSiteimprove Analytics+1
2025-07-07T05:33:07.224Z