Skip to main content

Security Directory

Explore comprehensive security analyses from websites around the world. Filter by industry, location, risk level, and more.

Live Guard activity

Security teams are checking their sites with Guard right now

Run your domain before the queue fills up

0
Websites
0
Industries
0
Countries
0
Avg Score
Page 916 of 2974|Showing 45751-45800 of 148685
lauraedwards.net favicon

LAURA EDWARDS

lauraedwards.net

0
OtherUnited KingdomsmallMEDIUM

The website www.lauraedwards.net is a personal portfolio site primarily showcasing photography and lifestyle content. It is hosted on the Squarespace platform, leveraging modern web technologies such as Typekit fonts and Google Fonts, with a responsive design optimized for mobile devices. The site presents a professional and consistent branding experience aimed at a general audience interested in visual arts and lifestyle imagery. However, the business model appears to be individual or small-scale personal branding without explicit commercial services or e-commerce functionality. From a technical perspective, the site is built on a stable and widely used CMS platform (Squarespace), ensuring reliable hosting and performance. The site uses HTTPS with a valid SSL certificate, enhancing security and user trust. However, there is a lack of advanced security headers and no visible analytics or tracking scripts, which may limit insights into user behavior but also reduces privacy concerns. Security posture is moderate; while HTTPS is enforced, the absence of security headers and privacy policies indicates room for improvement in compliance and protection. The WHOIS data for the domain is unavailable, which is unusual and reduces the trustworthiness of the domain registration. This discrepancy suggests either recent registration, privacy protection, or data unavailability, which should be further investigated. Overall, the website is functional and visually appealing but lacks critical compliance documentation such as privacy and cookie policies. The absence of WHOIS data and security policies lowers the overall risk profile. Strategic recommendations include implementing security headers, publishing privacy and cookie policies, and clarifying domain registration details to enhance trust and compliance.

35
35
17
55
62
75
100
portfoliophotographypersonalsquarespacelifestyle
SquarespaceTypekit fontsGoogle FontsJavaScript+2
2025-10-12T16:36:32.742Z
rmkinjurylaw.com favicon

The Law Office of Richard M. Kenny

rmkinjurylaw.com

0
OtherUnited StatessmallMEDIUM

The Law Office of Richard M. Kenny is a small, highly specialized personal injury law firm based in New York City, serving clients across multiple boroughs including Manhattan, Bronx, Brooklyn, Queens, and Nassau County. The firm emphasizes a client-focused approach with a strong track record of over $500 million recovered and more than 5,000 cases prepared for trial. Their services cover a broad range of personal injury and medical malpractice claims, positioning them as a top-rated legal service provider in the NYC market. Technically, the website is built on WordPress with modern plugins such as Gravity Forms for client intake and Yoast SEO for search optimization. The site demonstrates good mobile responsiveness, accessibility, and SEO practices. Security is well implemented with HTTPS and multiple security headers, though the absence of a visible cookie consent mechanism suggests room for improvement in privacy compliance. The security posture is solid with no detected vulnerabilities or exposed sensitive data. However, the lack of WHOIS data due to privacy protection slightly reduces transparency but is common for legal firms. Overall, the site is professional, trustworthy, and well-maintained, supporting the firm's market position. Strategically, the firm should enhance privacy compliance by implementing a cookie consent banner and consider publishing explicit security and incident response policies to further build client trust and meet regulatory requirements.

65
68
17
75
75
75
100
personalinjurylawyernyclegalservicesmedicalmalpractice+2 more
WordPressGravity FormsjQueryOwl Carousel+3
2025-10-12T15:34:51.341Z
martinezlawhouston.com favicon

The Martinez Law Firm - Houston DWI Lawyer

martinezlawhouston.com

0
OtherUnited StatessmallMEDIUM

The Martinez Law Firm is a specialized legal practice based in Houston, Texas, focusing on criminal defense and DWI cases. Led by attorney Herman Martinez, the firm boasts over 25 years of experience and a strong reputation in the Houston legal market. The firm targets individuals facing criminal charges in Houston and Harris County, offering personalized and client-driven legal services. Their market position is reinforced by numerous client testimonials, awards, and a high aggregate rating, positioning them as a trusted choice for criminal defense in the region. Technically, the website is built on WordPress using WPBakery Page Builder and NitroPack for performance optimization. It employs modern web technologies and is well-optimized for SEO and mobile devices, providing a fast and user-friendly experience. Security-wise, the site uses HTTPS with good SSL configuration but lacks some security headers and explicit security policies. Privacy compliance is partial, with a privacy policy present but no cookie consent mechanism detected. WHOIS data is incomplete or unavailable, which slightly reduces domain trustworthiness, but the professional website and business signals mitigate this concern. Overall, the site demonstrates strong business credibility and technical maturity with room for improvement in privacy and security transparency.

15
58
2
70
52
75
100
lawyercriminaldefensedwihoustonlegalservices+1 more
WordPressWPBakery Page BuilderNitroPackGoogle Tag Manager+2
2025-10-12T15:34:06.226Z
egochi.com favicon

Egochi Digital Marketing Agency

egochi.com

0
TechnologyUnited StatesmediumMEDIUM

Egochi Digital Marketing Agency is a professional, award-winning digital marketing firm specializing in SEO, PPC, content marketing, social media marketing, web design, and online reputation management. The company positions itself as a data-driven, client-focused agency delivering measurable results and sustainable growth for businesses. Their market presence is supported by multiple certifications and strong client testimonials, indicating a reputable and established business. Technically, the website is built on WordPress with modern plugins and tools such as Yoast SEO, Google Analytics, and Contact Form 7. The site is well-structured, mobile-optimized, and uses HTTPS, but lacks some advanced security headers and explicit privacy/cookie policies. The contact form includes CAPTCHA to mitigate spam. Security posture is generally good with HTTPS and no visible vulnerabilities, but the absence of security headers and a published security policy reduces the overall security maturity. The missing WHOIS registration data is a notable anomaly that requires further investigation to confirm domain legitimacy. Overall, the website is professional and trustworthy from a business and content perspective, but improvements in privacy compliance and security best practices are recommended to enhance trust and regulatory adherence.

20
53
17
75
75
75
100
digitalmarketingseoppccontentmarketingsocialmedia+4 more
WordPress CMSYoast SEO pluginGoogle AnalyticsGoogle Tag Manager+5
2025-10-12T15:33:56.176Z
davidhardawaylaw.com favicon

The Law Offices of David C. Hardaway

davidhardawaylaw.com

0
OtherUnited StatessmallHIGH

The Law Offices of David C. Hardaway is a specialized criminal defense law firm based in San Marcos, Texas, serving clients primarily in Hays County and surrounding Central Texas areas. The firm offers comprehensive legal defense services including DWI, drug crimes, violent crimes, and other serious criminal charges. The website is professionally designed with rich content, detailed FAQs, attorney profiles, case results, and client testimonials, positioning the firm as a reputable and trusted legal service provider in the region. The firm holds multiple industry recognitions and certifications, enhancing its market credibility. Technically, the website is built on WordPress with modern JavaScript libraries such as jQuery and Swiper.js, and uses Google Fonts and Google Tag Manager for analytics and tracking. The site employs HTTPS with good SSL configuration and includes spam protection via Google reCAPTCHA on its contact form. However, it lacks visible security headers and cookie consent mechanisms, which are recommended for improved security and privacy compliance. From a security perspective, the site shows good practices like HTTPS enforcement and no exposed sensitive data, but the absence of WHOIS data for the domain raises concerns about domain registration legitimacy. Despite this, the website content and structure strongly indicate a legitimate business operation. Overall, the site scores well on content quality, business credibility, and technical implementation but should address privacy compliance and security header improvements. Strategically, the firm should verify domain registration details, implement comprehensive privacy and cookie policies with consent mechanisms, and enhance security headers to strengthen trust and compliance. These improvements will support the firm's professional image and reduce potential risks related to privacy and security.

15
53
17
70
72
75
-
lawfirmcriminaldefensedwilawyersanmarcostexas+4 more
WordPressjQuerySwiper.jsGoogle Fonts+5

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:46.044Z
farmerclinecampbell.com favicon

Farmer, Cline & Campbell Personal Injury Lawyers

farmerclinecampbell.com

0
OtherUnited StatesmediumMEDIUM

Farmer, Cline & Campbell Personal Injury Lawyers is a well-established personal injury law firm based in Charleston, West Virginia, with nearly 30 years of experience and over 300 years of combined attorney experience. The firm specializes in a wide range of personal injury cases including vehicle accidents, catastrophic injuries, and wrongful death. They have a strong market position supported by numerous legal awards, certifications, and a large volume of positive client reviews. Their business model focuses on providing expert legal representation to injured individuals in West Virginia, offering free consultations and emphasizing client trust and success. Technically, the website is built on WordPress with modern performance optimizations such as NitroPack, and integrates popular tools like Gravity Forms and Google Analytics. The site is mobile-optimized, fast-loading, and professionally designed, providing an excellent user experience. Security posture is good with HTTPS and reCAPTCHA protections, though it lacks some advanced security headers and DNSSEC. Privacy compliance is limited due to the absence of explicit privacy and cookie policies. Overall, the website reflects a credible and professional legal service provider with strong business credibility but could improve privacy transparency and security hardening.

15
53
17
40
52
75
100
personalinjurylawyerlegalserviceswestvirginiacharleston+5 more
WordPressGravity FormsNitroPackGoogle Fonts+4
2025-10-12T15:33:41.008Z
fanninglawllc.com favicon

Fanning Law, LLC

fanninglawllc.com

0
OtherUnited StatessmallMEDIUM

Fanning Law, LLC is a well-established small law firm specializing in family law services in Southern Maryland, particularly La Plata and Charles County. Led by attorney William C. Fanning Jr., the firm offers comprehensive legal assistance in divorce, child custody, support, property division, and related family law matters, with additional practice areas in personal injury, criminal defense, and business law. The website reflects a professional and client-focused approach with detailed content, testimonials, and local expertise. Technically, the website is built on WordPress with modern libraries such as jQuery and Swiper, and integrates Google Fonts and Google Tag Manager for analytics. The site is mobile-optimized, accessible, and performs moderately well. Security measures include HTTPS and Google reCAPTCHA on forms, though security headers are not detected, and privacy compliance could be improved with explicit policies and cookie consent mechanisms. The security posture is solid with no visible vulnerabilities or exposed sensitive data, but the absence of WHOIS data and domain registration details introduces some uncertainty about domain legitimacy. However, the professional presentation and detailed business information mitigate these concerns. Overall, the site is trustworthy and serves its target audience effectively. Recommendations include enhancing privacy and cookie policies, implementing security headers, publishing incident response contacts, and regular security audits to maintain compliance and trust.

55
53
17
75
72
75
-
familylawdivorcelegalservicesmarylandlawyer+3 more
WordPressjQuery 3.7.1Swiper 6.5.4Google Fonts+2

Partner Domains:

milemarkmedia.com
partner
2025-10-12T15:33:20.723Z
mrlevelhead.com favicon

Mr. Level Head

mrlevelhead.com

0
OtherUnited StatessmallHIGH

Mr. Level Head is a small, local handyman and home repair service provider based in Spring Hill, Florida, serving Hernando and Pasco counties. The company offers a wide range of home repair services including door repair, electrical work, painting, drywall repair, furniture assembly, plumbing, and more. The website positions the business as reliable and detail-oriented, supported by multiple positive customer testimonials and local business listings such as BBB and Yelp. The business model is straightforward, charging by the job with flexible scheduling and a one-year labor warranty, targeting homeowners and residents in the local area. Technically, the website is built on WordPress using the Elementor page builder and related plugins, leveraging modern web technologies such as jQuery, Font Awesome, and Google Fonts. The site is hosted likely via GoDaddy, with a moderate performance profile and good mobile optimization. SEO is well addressed with proper meta tags, structured data (JSON-LD), and clear navigation. However, accessibility is basic and could be improved. From a security perspective, the site uses HTTPS with a good SSL configuration but lacks advanced security headers and DNSSEC. No privacy or cookie policies are present, indicating compliance gaps especially regarding GDPR. There is no visible incident response or vulnerability disclosure information. Analytics and tracking are implemented via Google Analytics, Ahrefs, and StatCounter, with moderate user tracking levels but limited privacy transparency. Overall, the website is professional and trustworthy for its business purpose but would benefit from enhanced privacy compliance, improved security headers, and clearer policies to strengthen user trust and regulatory adherence.

15
35
17
55
72
80
40
handymanhomerepairlocalbusinessspringhillflhomeservices+1 more
WordPressElementorElementor ProjQuery+3
2025-10-12T15:32:50.656Z
lmsqueezy.com favicon

Lemon Squeezy, LLC

lmsqueezy.com

0
TechnologyN/amediumMEDIUM

Lemon Squeezy, LLC operates a professional SaaS platform focused on providing payments, subscription management, global tax compliance, and marketing tools tailored for software companies and digital product creators. The company positions itself as a trusted all-in-one solution, serving thousands of customers globally with a strong emphasis on ease of use and developer friendliness. Their platform integrates with major payment processors like Stripe and supports a wide range of payment methods and currencies. Technically, the website is built using modern web technologies including Webflow CMS, jQuery, and REST APIs with webhook support. Hosting and CDN services appear to be provided via Cloudflare, ensuring fast performance and good mobile optimization. The site demonstrates good SEO and accessibility practices, with comprehensive documentation and developer resources. From a security perspective, the site enforces HTTPS and uses Stripe for secure payment processing. AI-driven fraud prevention is highlighted as a key feature. However, explicit security headers and a published security policy or incident response contacts are not evident. Privacy compliance is partially addressed with a privacy policy and terms of service, but no visible cookie consent mechanism was detected. Overall, the website presents a high level of professionalism and trustworthiness, though the absence of WHOIS data and cookie consent slightly reduce transparency. The platform is well-suited for SaaS businesses seeking a comprehensive payment and subscription solution with integrated marketing and reporting tools.

80
53
2
85
75
85
100
paymentssubscriptionssaasecommercetaxcompliance+3 more
jQuery 3.6.0REST APIWebhooksCloudflare (inferred from scripts)+1

Partner Domains:

stripe.com
partner
2025-10-12T15:32:13.578Z
polar.sh favicon

Polar Software Inc.

polar.sh

0
TechnologyUnited StatessmallMEDIUM

Polar Software Inc. is a technology startup founded in 2022, providing modern payment infrastructure solutions tailored for the 21st century. Their platform offers comprehensive services including payments, usage and billing, customer management, and global merchant of record capabilities. Positioned as a developer-friendly SaaS solution, Polar targets software creators and SaaS companies seeking seamless monetization and compliance with tax regulations. The company has secured a $10M seed round and maintains an open source presence, enhancing its credibility and community engagement. Technically, Polar leverages modern web technologies such as React and Next.js, hosted likely on cloud platforms with Cloudflare DNS services. The website demonstrates excellent performance, mobile optimization, and SEO practices. Integration with Google Analytics and Stripe Connect indicates a mature digital infrastructure supporting analytics and payment processing. From a security perspective, the site enforces HTTPS and employs domain transfer protection. However, DNSSEC is not enabled, and explicit security headers are not clearly visible. The absence of a published security policy or incident response contact suggests room for improvement in transparency and readiness. No vulnerabilities or exposed sensitive data were detected in the analysis. Overall, Polar presents a professional, trustworthy online presence with strong business and technical foundations. Strategic recommendations include enhancing security headers, enabling DNSSEC, publishing security policies, and establishing a vulnerability disclosure program to further strengthen trust and compliance.

70
68
2
85
72
80
100
paymentsaasmerchantofrecordbillingsubscriptions+3 more
ReactNext.jsCloudflare DNSGoogle Analytics+1
2025-10-12T15:31:43.383Z
betterstack.com favicon

Better Stack

betterstack.com

0
TechnologyN/amediumMEDIUM

Better Stack is a technology company providing an AI-native SaaS platform focused on observability and incident management. Their offerings include monitoring, status pages, tracing, infrastructure monitoring, and log management, targeting developers, SREs, and IT teams. The company positions itself as a modern alternative to legacy tools, emphasizing ease of use and AI-driven insights. The website is professionally designed with excellent content quality and clear navigation, reflecting a mature digital presence. Technically, the site uses modern JavaScript frameworks such as Vue.js and Pinia, with a Ruby on Rails backend inferred from Turbo Rails usage. Hosting and DNS are managed via Cloudflare, ensuring good performance and security. The security posture is strong with HTTPS, CSRF protections, and Sentry integration for error monitoring, though some improvements like enabling DNSSEC and publishing explicit security policies are recommended. Privacy compliance is basic, with a cookie consent mechanism but no visible privacy policy or terms of service pages in the provided content. Contact information is limited to a signup form without direct emails or phone numbers. The domain WHOIS data is consistent and indicates a legitimate, well-established business. Overall, Better Stack demonstrates a high level of professionalism and technical maturity with room for enhanced transparency in privacy and security disclosures.

65
80
14
75
75
75
100
observabilityincidentmanagementmonitoringlogmanagementtracing+4 more
Vue.js 3PiniaStimulusTurbo Rails+9

Partner Domains:

betteruptime.com
subsidiary
logtail.com
subsidiary

+3 more partners

2025-10-12T15:31:33.360Z